Gene Gene information from NCBI Gene database.
Entrez ID 991
Gene name Cell division cycle 20
Gene symbol CDC20
Synonyms (NCBI Gene)
CDC20AOOMD14OZEMA14bA276H19.3p55CDC
Chromosome 1
Chromosome location 1p34.2
Summary CDC20 appears to act as a regulatory protein interacting with several other proteins at multiple points in the cell cycle. It is required for two microtubule-dependent processes, nuclear movement prior to anaphase and chromosome separation. [provided by
miRNA miRNA information provided by mirtarbase database.
15
miRTarBase ID miRNA Experiments Reference
MIRT016385 hsa-miR-193b-3p Microarray 20304954
MIRT024643 hsa-miR-215-5p Microarray 19074876
MIRT025414 hsa-miR-34a-5p Proteomics 21566225
MIRT026319 hsa-miR-192-5p Microarray 19074876
MIRT028518 hsa-miR-30a-5p Proteomics 18668040
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Transcription factor Regulation Reference
PHF8 Unknown 23979597
YBX1 Repression 20596676
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
58
GO ID Ontology Definition Evidence Reference
GO:0000086 Process G2/M transition of mitotic cell cycle IDA 27030811
GO:0000086 Process G2/M transition of mitotic cell cycle NAS 17495531
GO:0000775 Component Chromosome, centromeric region IEA
GO:0000776 Component Kinetochore IEA
GO:0000776 Component Kinetochore ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603618 1723 ENSG00000117399
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q12834
Protein name Cell division cycle protein 20 homolog (p55CDC)
Protein function Substrate-specific adapter of the anaphase promoting complex/cyclosome (APC/C) complex that confers substrate specificity by binding to substrates and targeting them to the APC/C complex for ubiquitination and degradation (PubMed:9734353, PubMed
PDB 4GGA , 4GGC , 4GGD , 4N14 , 5G04 , 5KHR , 5KHU , 5LCW , 6F0X , 6Q6G , 6Q6H , 9I68 , 9I69 , 9I6A
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12894 ANAPC4_WD40 218 279 Anaphase-promoting complex subunit 4 WD40 domain Repeat
PF00400 WD40 299 336 WD domain, G-beta repeat Repeat
PF00400 WD40 345 386 WD domain, G-beta repeat Repeat
PF00400 WD40 390 429 WD domain, G-beta repeat Repeat
PF00400 WD40 433 471 WD domain, G-beta repeat Repeat
Sequence
MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTP
GKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNL
NGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPE
IRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNY
LAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSY
ILSSGSRSGHIHHHDVRVAEH
HVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVW
PSAPGEGGWVPLQTFTQHQGAVKA
VAWCPWQSNVLATGGGTSDRHIRIWN
VCSGACLSAVDAHSQVCSILWSPHYKELISGHGF
AQNQLVIWK
YPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARR
REREKASAAKSSLIHQGIR
Sequence length 499
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Human T-cell leukemia virus 1 infection
Viral carcinogenesis
  Inhibition of the proteolytic activity of APC/C required for the onset of anaphase by mitotic spindle checkpoint components
Inactivation of APC/C via direct inhibition of the APC/C complex
Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
APC/C:Cdc20 mediated degradation of Cyclin B
SCF-beta-TrCP mediated degradation of Emi1
APC/C:Cdc20 mediated degradation of Securin
APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
Cdc20:Phospho-APC/C mediated degradation of Cyclin A
Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase
Regulation of APC/C activators between G1/S and early anaphase
APC/C:Cdc20 mediated degradation of mitotic proteins
Phosphorylation of Emi1
APC-Cdc20 mediated degradation of Nek2A
Separation of Sister Chromatids
Resolution of Sister Chromatid Cohesion
RHO GTPases Activate Formins
Ub-specific processing proteases
Mitotic Prometaphase
EML4 and NUDC in mitotic spindle formation
Antigen processing: Ubiquitination & Proteasome degradation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
4
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Clear cell carcinoma of kidney Likely pathogenic rs752709238 RCV005937376
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Oocyte maturation defect 14 Pathogenic; Likely pathogenic rs1309457938, rs140305765, rs2545698654, rs2545699267, rs766199335, rs2545698940, rs754957702, rs372597302, rs760334505, rs757848486, rs752709238 RCV003152524
RCV003152525
RCV003152526
RCV003152527
RCV003152528
View all (6 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CARCINOMA, HEPATOCELLULAR CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
OOCYTE/ZYGOTE/EMBRYO MATURATION ARREST 14 Disgenet, HPO
Disgenet, HPO
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 28349831, 29608985, 30588191
★☆☆☆☆
Found in Text Mining only
Adrenocortical Carcinoma Adrenocortical carcinoma Pubtator 37535572 Associate
★☆☆☆☆
Found in Text Mining only
Aneuploidy Aneuploidy Pubtator 20034488, 33094908 Associate
★☆☆☆☆
Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA Syndromic microphthalmia BEFREE 22475564, 31814735
★☆☆☆☆
Found in Text Mining only
Arthritis Rheumatoid Rheumatoid arthritis Pubtator 32840301 Associate
★☆☆☆☆
Found in Text Mining only
Astrocytoma Astrocytoma BEFREE 28432586
★☆☆☆☆
Found in Text Mining only
Ataxia Telangiectasia Ataxia telangiectasia Pubtator 35782055 Associate
★☆☆☆☆
Found in Text Mining only
Bladder Neoplasm Bladder Neoplasm BEFREE 23995871, 29375713
★☆☆☆☆
Found in Text Mining only
Brain Neoplasms Brain Neoplasms BEFREE 26074073
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 24853182, 28617439, 30038716, 30222931, 31081056, 31471836, 31669221
★☆☆☆☆
Found in Text Mining only