Gene Gene information from NCBI Gene database.
Entrez ID 9908
Gene name G3BP stress granule assembly factor 2
Gene symbol G3BP2
Synonyms (NCBI Gene)
-
Chromosome 4
Chromosome location 4q21.1
miRNA miRNA information provided by mirtarbase database.
1003
miRTarBase ID miRNA Experiments Reference
MIRT000772 hsa-miR-200a-3p MicroarrayNorthern blot 16331254
MIRT020092 hsa-miR-361-5p Sequencing 20371350
MIRT022458 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT023607 hsa-miR-1-3p Proteomics 18668040
MIRT025342 hsa-miR-34a-5p Proteomics 21566225
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
24
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003723 Function RNA binding IEA
GO:0003729 Function MRNA binding IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
620020 30291 ENSG00000138757
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UN86
Protein name Ras GTPase-activating protein-binding protein 2 (G3BP-2) (GAP SH3 domain-binding protein 2)
Protein function Scaffold protein that plays an essential role in cytoplasmic stress granule formation which acts as a platform for antiviral signaling (PubMed:23279204, PubMed:32302570, PubMed:32302571, PubMed:32302572). Plays an essential role in stress granul
PDB 5DRV
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02136 NTF2 11 133 Nuclear transport factor 2 (NTF2) domain Domain
PF00076 RRM_1 333 398 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Sequence
MVMEKPSPLLVGREFVRQYYTLLNKAPEYLHRFYGRNSSYVHGGVDASGKPQEAVYGQND
IHHKVLSLNFSECHTKIRHVDAHATLSDGVVVQVMGLLSNSGQPERKFMQTFVLAPEGSV
PNKFYVHNDMFRY
EDEVFGDSEPELDEESEDEVEEEQEERQPSPEPVQENANSGYYEAHP
VTNGIEEPLEESSHEPEPEPESETKTEELKPQVEEKNLEELEEKSTTPPPAEPVSLPQEP
PKAFSWASVTSKNLPPSGTVSSSGIPPHVKAPVSQPRVEAKPEVQSQPPRVREQRPRERP
GFPPRGPRPGRGDMEQNDSDNRRIIRYPDSHQLFVGNLPHDIDENELKEFFMSFGNVVEL
RINTKGVGGKLPNFGFVVFDDSEPVQRILIAKPIMFRG
EVRLNVEEKKTRAARERETRGG
GDDRRDIRRNDRGPGGPRGIVGGGMMRDRDGRGPPPRGGMAQKLGSGRGTGQMEGRFTGQ
RR
Sequence length 482
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ALZHEIMER DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Breast Carcinoma Breast Carcinoma BEFREE 28096337
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 35761386, 37461019 Associate
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 36878903 Associate
★☆☆☆☆
Found in Text Mining only
Esophageal Squamous Cell Carcinoma Esophageal squamous cell carcinoma Pubtator 33476486 Associate
★☆☆☆☆
Found in Text Mining only
Gastritis Gastritis BEFREE 30455363
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of breast Breast Cancer BEFREE 28096337
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of breast Breast Cancer UNIPROT_DG
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of prostate Prostate cancer BEFREE 28692047, 29378906, 29379164
★☆☆☆☆
Found in Text Mining only
Mammary Neoplasms Mammary Neoplasms BEFREE 25893917, 28096337
★☆☆☆☆
Found in Text Mining only
Melanoma Melanoma Pubtator 21343389 Associate
★☆☆☆☆
Found in Text Mining only