Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9891
Gene name	NUAK family kinase 1
Gene symbol	NUAK1
Synonyms (NCBI Gene)	ARK5
Chromosome	12
Chromosome location	12q23.3

153

Show/Hide all (153)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021136	hsa-miR-186-5p	Sequencing	20371350
MIRT023849	hsa-miR-1-3p	Microarray	18668037
MIRT028149	hsa-miR-93-5p	Sequencing	20371350
MIRT050078	hsa-miR-26a-5p	CLASH	23622248
MIRT438079	hsa-miR-211-5p	Luciferase reporter assayWestern blotqRT-PCR	23934065
MIRT438079	hsa-miR-211-5p	Luciferase reporter assayWestern blotqRT-PCR	23934065
MIRT438079	hsa-miR-211-5p	Luciferase reporter assayWestern blotqRT-PCR	23934065
MIRT438079	hsa-miR-211-5p	Luciferase reporter assayWestern blotqRT-PCR	23934065
MIRT438079	hsa-miR-211-5p	Luciferase reporter assayWestern blotqRT-PCR	23934065
MIRT438079	hsa-miR-211-5p	Luciferase reporter assayWestern blotqRT-PCR	23934065
MIRT438079	hsa-miR-211-5p	Luciferase reporter assayWestern blotqRT-PCR	23934065
MIRT438079	hsa-miR-211-5p	Luciferase reporter assayWestern blotqRT-PCR	23934065
MIRT655709	hsa-miR-556-3p	HITS-CLIP	23824327
MIRT440086	hsa-miR-770-5p	HITS-CLIP	24374217
MIRT440086	hsa-miR-770-5p	HITS-CLIP	24374217
MIRT733136	hsa-miR-30b-5p	Luciferase reporter assayqRT-PCRWestern blotting	31949655
MIRT655709	hsa-miR-556-3p	HITS-CLIP	23824327
MIRT756449	hsa-miR-424-5p	Luciferase reporter assay	34097192
MIRT1196381	hsa-miR-103a	CLIP-seq
MIRT1196382	hsa-miR-105	CLIP-seq
MIRT1196383	hsa-miR-107	CLIP-seq
MIRT1196384	hsa-miR-1200	CLIP-seq
MIRT1196385	hsa-miR-1238	CLIP-seq
MIRT1196386	hsa-miR-126	CLIP-seq
MIRT1196387	hsa-miR-127-5p	CLIP-seq
MIRT1196388	hsa-miR-1290	CLIP-seq
MIRT739840	hsa-miR-1470	CLIP-seq
MIRT1196389	hsa-miR-15a	CLIP-seq
MIRT1196390	hsa-miR-15b	CLIP-seq
MIRT1196391	hsa-miR-16	CLIP-seq
MIRT1196392	hsa-miR-182	CLIP-seq
MIRT1196393	hsa-miR-193a-5p	CLIP-seq
MIRT1196394	hsa-miR-195	CLIP-seq
MIRT1196395	hsa-miR-196a	CLIP-seq
MIRT1196396	hsa-miR-196b	CLIP-seq
MIRT1196397	hsa-miR-1973	CLIP-seq
MIRT1196398	hsa-miR-214	CLIP-seq
MIRT1196399	hsa-miR-22	CLIP-seq
MIRT1196400	hsa-miR-224	CLIP-seq
MIRT1196401	hsa-miR-2355-5p	CLIP-seq
MIRT1196402	hsa-miR-28-5p	CLIP-seq
MIRT1196403	hsa-miR-3124-3p	CLIP-seq
MIRT1196404	hsa-miR-3127-3p	CLIP-seq
MIRT1196405	hsa-miR-3139	CLIP-seq
MIRT1196406	hsa-miR-3140-5p	CLIP-seq
MIRT1196407	hsa-miR-3148	CLIP-seq
MIRT1196408	hsa-miR-3167	CLIP-seq
MIRT1196409	hsa-miR-3173-3p	CLIP-seq
MIRT1196410	hsa-miR-3614-5p	CLIP-seq
MIRT1196411	hsa-miR-3619-5p	CLIP-seq
MIRT1196412	hsa-miR-3667-3p	CLIP-seq
MIRT1196413	hsa-miR-3689d	CLIP-seq
MIRT1196414	hsa-miR-3691-5p	CLIP-seq
MIRT1196415	hsa-miR-3923	CLIP-seq
MIRT1196416	hsa-miR-3927	CLIP-seq
MIRT1196417	hsa-miR-3929	CLIP-seq
MIRT1196418	hsa-miR-424	CLIP-seq
MIRT1196419	hsa-miR-4419b	CLIP-seq
MIRT1196420	hsa-miR-4436b-3p	CLIP-seq
MIRT1196421	hsa-miR-4457	CLIP-seq
MIRT1196422	hsa-miR-4462	CLIP-seq
MIRT1196423	hsa-miR-4469	CLIP-seq
MIRT1196424	hsa-miR-4470	CLIP-seq
MIRT1196425	hsa-miR-4478	CLIP-seq
MIRT1196426	hsa-miR-4491	CLIP-seq
MIRT1196427	hsa-miR-4530	CLIP-seq
MIRT1196428	hsa-miR-4635	CLIP-seq
MIRT1196429	hsa-miR-4640-3p	CLIP-seq
MIRT1196430	hsa-miR-4640-5p	CLIP-seq
MIRT1196431	hsa-miR-4655-3p	CLIP-seq
MIRT1196432	hsa-miR-4657	CLIP-seq
MIRT739839	hsa-miR-4667-3p	CLIP-seq
MIRT1196433	hsa-miR-4687-3p	CLIP-seq
MIRT739837	hsa-miR-4687-5p	CLIP-seq
MIRT1196434	hsa-miR-4691-5p	CLIP-seq
MIRT1196435	hsa-miR-4705	CLIP-seq
MIRT1196436	hsa-miR-4726-5p	CLIP-seq
MIRT1196437	hsa-miR-4752	CLIP-seq
MIRT739841	hsa-miR-4760-3p	CLIP-seq
MIRT1196438	hsa-miR-4765	CLIP-seq
MIRT1196439	hsa-miR-483-3p	CLIP-seq
MIRT1196440	hsa-miR-488	CLIP-seq
MIRT1196441	hsa-miR-497	CLIP-seq
MIRT1196442	hsa-miR-545	CLIP-seq
MIRT1196443	hsa-miR-548aa	CLIP-seq
MIRT1196444	hsa-miR-548n	CLIP-seq
MIRT1196445	hsa-miR-548t	CLIP-seq
MIRT1196446	hsa-miR-548u	CLIP-seq
MIRT1196447	hsa-miR-570	CLIP-seq
MIRT1196448	hsa-miR-583	CLIP-seq
MIRT1196449	hsa-miR-603	CLIP-seq
MIRT1196450	hsa-miR-616	CLIP-seq
MIRT1196451	hsa-miR-708	CLIP-seq
MIRT1196452	hsa-miR-761	CLIP-seq
MIRT739838	hsa-miR-766	CLIP-seq
MIRT1196453	hsa-miR-767-3p	CLIP-seq
MIRT1196454	hsa-miR-876-5p	CLIP-seq
MIRT1196381	hsa-miR-103a	CLIP-seq
MIRT1196383	hsa-miR-107	CLIP-seq
MIRT2056983	hsa-miR-145	CLIP-seq
MIRT1196401	hsa-miR-2355-5p	CLIP-seq
MIRT1196412	hsa-miR-3667-3p	CLIP-seq
MIRT1196413	hsa-miR-3689d	CLIP-seq
MIRT1196415	hsa-miR-3923	CLIP-seq
MIRT2056984	hsa-miR-4287	CLIP-seq
MIRT2056985	hsa-miR-4299	CLIP-seq
MIRT2056986	hsa-miR-4312	CLIP-seq
MIRT1196423	hsa-miR-4469	CLIP-seq
MIRT2056987	hsa-miR-4685-3p	CLIP-seq
MIRT1196435	hsa-miR-4705	CLIP-seq
MIRT2056988	hsa-miR-4708-3p	CLIP-seq
MIRT1196439	hsa-miR-483-3p	CLIP-seq
MIRT1196448	hsa-miR-583	CLIP-seq
MIRT2056989	hsa-miR-668	CLIP-seq
MIRT2056990	hsa-miR-873	CLIP-seq
MIRT1196381	hsa-miR-103a	CLIP-seq
MIRT1196383	hsa-miR-107	CLIP-seq
MIRT2056983	hsa-miR-145	CLIP-seq
MIRT1196389	hsa-miR-15a	CLIP-seq
MIRT1196390	hsa-miR-15b	CLIP-seq
MIRT1196391	hsa-miR-16	CLIP-seq
MIRT1196394	hsa-miR-195	CLIP-seq
MIRT1196398	hsa-miR-214	CLIP-seq
MIRT2285412	hsa-miR-3065-3p	CLIP-seq
MIRT2285413	hsa-miR-3185	CLIP-seq
MIRT2285414	hsa-miR-3187-3p	CLIP-seq
MIRT1196411	hsa-miR-3619-5p	CLIP-seq
MIRT1196417	hsa-miR-3929	CLIP-seq
MIRT1196418	hsa-miR-424	CLIP-seq
MIRT1196419	hsa-miR-4419b	CLIP-seq
MIRT1196420	hsa-miR-4436b-3p	CLIP-seq
MIRT1196425	hsa-miR-4478	CLIP-seq
MIRT1196427	hsa-miR-4530	CLIP-seq
MIRT1196428	hsa-miR-4635	CLIP-seq
MIRT1196430	hsa-miR-4640-5p	CLIP-seq
MIRT1196433	hsa-miR-4687-3p	CLIP-seq
MIRT1196436	hsa-miR-4726-5p	CLIP-seq
MIRT1196441	hsa-miR-497	CLIP-seq
MIRT1196452	hsa-miR-761	CLIP-seq
MIRT2391792	hsa-miR-339-5p	CLIP-seq
MIRT1196412	hsa-miR-3667-3p	CLIP-seq
MIRT2056984	hsa-miR-4287	CLIP-seq
MIRT2056985	hsa-miR-4299	CLIP-seq
MIRT1196423	hsa-miR-4469	CLIP-seq
MIRT2056987	hsa-miR-4685-3p	CLIP-seq
MIRT2391793	hsa-miR-4713-5p	CLIP-seq
MIRT2056989	hsa-miR-668	CLIP-seq
MIRT2056985	hsa-miR-4299	CLIP-seq
MIRT2056989	hsa-miR-668	CLIP-seq
MIRT2686668	hsa-miR-3157-5p	CLIP-seq
MIRT2056985	hsa-miR-4299	CLIP-seq
MIRT2686669	hsa-miR-4691-3p	CLIP-seq
MIRT2056989	hsa-miR-668	CLIP-seq

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001650	Component	Fibrillar center	IDA
GO:0002039	Function	P53 binding	IPI	21317932
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	19927127, 20354225, 21317932
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	16306228, 19927127, 20354225, 21317932, 25329316, 25852190, 32707033
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	21317932
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	21317932
GO:0005737	Component	Cytoplasm	IEA
GO:0006468	Process	Protein phosphorylation	IDA	25329316
GO:0006974	Process	DNA damage response	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030155	Process	Regulation of cell adhesion	IDA	20354225
GO:0042127	Process	Regulation of cell population proliferation	TAS	21317932
GO:0046872	Function	Metal ion binding	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	TAS
GO:2000772	Process	Regulation of cellular senescence	IDA	19927127

MIM	HGNC	e!Ensembl
608130	14311	ENSG00000074590

O60285

Protein name

NUAK family SNF1-like kinase 1 (EC 2.7.11.1) (AMPK-related protein kinase 5) (ARK5) (Omphalocele kinase 1)

Protein function

Serine/threonine-protein kinase involved in various processes such as cell adhesion, regulation of cell ploidy and senescence, cell proliferation and tumor progression. Phosphorylates ATM, CASP6, LATS1, PPP1R12A and p53/TP53. Acts as a regulator

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	55 → 306	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed at high levels in heart and brain, and at lower levels in skeletal muscle, kidney, ovary, placenta, lung and liver. Highly up-regulated in colorectal cancer cell lines. {ECO:0000269|PubMed:14982852}.

Sequence

MEGAAAPVAGDRPDLGLGAPGSPREAVAGATAALEPRKPHGVKRHHHKHNLKHRYELQET
LGKGTYGKVKRATERFSGRVVAIKSIRKDKIKDEQDMVHIRREIEIMSSLNHPHIISIYE
VFENKDKIVIIMEYASKGELYDYISERRRLSERETRHFFRQIVSAVHYCHKNGVVHRDLK
LENILLDDNCNIKIADFGLSNLYQKDKFLQTFCGSPLYASPEIVNGRPYRGPEVDSWALG
VLLYTLVYGTMPFDGFDHKNLIRQISSGEYREPTQPSDARGLIRWMLMVNPDRRATIEDI
ANHWWVNWGYKSSVCDCDALHDSESPLLARIIDWHHRSTGLQADTEAKMKGLAKPTTSEV
MLERQRSLKKSKKENDFAQSGQDAVPESPSKLSSKRPKGILKKRSNSEHRSHSTGFIEGV
VGPALPSTFKMEQDLCRTGVLLPSSPEAEVPGKLSPKQSATMPKKGILKKTQQRESGYYS
SPERSESSELLDSNDVMGSSIPSPSPPDPARVTSHSLSCRRKGILKHSSKYSAGTMDPAL
VSPEMPTLESLSEPGVPAEGLSRSYSRPSSVISDDSVLSSDSFDLLDLQENRPARQRIRS
CVSAENFLQIQDFEGLQNRPRPQYLKRYRNRLADSSFSLLTDMDDVTQVYKQALEICSKL
N

Sequence length

661

Interactions

View interactions

	Reactome
			Regulation of TP53 Activity through Phosphorylation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATOCONUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NUAK1-related disorder	Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (66)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	12409306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	GWASCAT_DG	26174813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	30327473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30168179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22105900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29566768, 32418991	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	34465876	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	16044163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23516026, 32755597	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30168179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	36975767	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37996927	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	24565165, 38131232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26151663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	37473923	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	28832761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	28832761, 31360102	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	23459936	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29467884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16044163, 29500295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	14982852	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	29500295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	37236919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29106388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29106388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	29106388	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	22266139	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	22266139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	26882562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	26882562	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	16014625	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	26255969, 31360102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22460906, 23516026, 25242509, 27126361, 29434843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26882562	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	26882562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22105900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30807203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26151663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25242509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28662499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30168179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15060171, 15354411, 28662499, 29215719, 29500295, 30701428, 31090959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29467884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	29566768		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	23934065, 25242509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	23934065	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	23934065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	16044163		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	CTD_human_DG	26873845		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	29215719, 29575772, 30121842, 31819474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	13679856, 15060171, 21317932, 22105900, 23516026, 26255969, 28469776, 29106388, 30121842, 30168179, 30662653, 30807203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	29106388	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23215946, 25242509, 25412236, 28469776		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26151663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25242509, 30662653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	14982852, 33000197, 36975767	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	30327473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	37236919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26882562	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	26882562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28662499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35872695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	16424013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	27720485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34326372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	38131232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

NUAK1 (NUAK family kinase 1)