Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9868
Gene name	Translocase of outer mitochondrial membrane 70
Gene symbol	TOMM70
Synonyms (NCBI Gene)	TOMM70ATom70
Chromosome	3
Chromosome location	3q12.2
Summary	This gene encodes an import receptor of the outer mitochondrial membrane that is part of the translocase of the outer membrane complex. This protein is involved in the import of mitochondrial precursor proteins. [provided by RefSeq, Oct 2011]

Show/Hide all (34)

miRTarBase ID	miRNA	Experiments	Reference
MIRT509948	hsa-miR-5693	PAR-CLIP	20371350
MIRT509949	hsa-miR-6499-3p	PAR-CLIP	20371350
MIRT509947	hsa-miR-3135b	PAR-CLIP	20371350
MIRT509946	hsa-miR-504-3p	PAR-CLIP	20371350
MIRT509945	hsa-miR-122-5p	PAR-CLIP	20371350
MIRT509944	hsa-miR-3652	PAR-CLIP	20371350
MIRT509943	hsa-miR-4430	PAR-CLIP	20371350
MIRT509942	hsa-miR-143-5p	PAR-CLIP	20371350
MIRT509941	hsa-miR-5698	PAR-CLIP	20371350
MIRT531319	hsa-miR-6890-5p	PAR-CLIP	22012620
MIRT531318	hsa-miR-764	PAR-CLIP	22012620
MIRT509948	hsa-miR-5693	PAR-CLIP	22012620
MIRT531317	hsa-miR-3665	PAR-CLIP	22012620
MIRT509949	hsa-miR-6499-3p	PAR-CLIP	22012620
MIRT509947	hsa-miR-3135b	PAR-CLIP	22012620
MIRT509946	hsa-miR-504-3p	PAR-CLIP	22012620
MIRT509945	hsa-miR-122-5p	PAR-CLIP	22012620
MIRT509944	hsa-miR-3652	PAR-CLIP	22012620
MIRT509943	hsa-miR-4430	PAR-CLIP	22012620
MIRT531316	hsa-miR-615-5p	PAR-CLIP	22012620
MIRT531315	hsa-miR-7704	PAR-CLIP	22012620
MIRT531314	hsa-miR-193a-5p	PAR-CLIP	22012620
MIRT531313	hsa-miR-431-5p	PAR-CLIP	22012620
MIRT509942	hsa-miR-143-5p	PAR-CLIP	22012620
MIRT509941	hsa-miR-5698	PAR-CLIP	22012620
MIRT509948	hsa-miR-5693	PAR-CLIP	23446348
MIRT509949	hsa-miR-6499-3p	PAR-CLIP	23446348
MIRT509947	hsa-miR-3135b	PAR-CLIP	23446348
MIRT509946	hsa-miR-504-3p	PAR-CLIP	23446348
MIRT509945	hsa-miR-122-5p	PAR-CLIP	23446348
MIRT509944	hsa-miR-3652	PAR-CLIP	23446348
MIRT509943	hsa-miR-4430	PAR-CLIP	23446348
MIRT509942	hsa-miR-143-5p	PAR-CLIP	23446348
MIRT509941	hsa-miR-5698	PAR-CLIP	23446348

Show/Hide all (1)

Transcription factor	Regulation	Reference
GABPA	Activation	17167546

Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002218	Process	Activation of innate immune response	IDA	20628368
GO:0002230	Process	Positive regulation of defense response to virus by host	IDA	20628368
GO:0005515	Function	Protein binding	IPI	12526792, 20628368, 23911537, 25609812, 32353859, 32728199, 33060197, 33845483, 33990585, 34232536, 34502139, 34942634, 35391620, 36217030
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	20531390, 20628368, 25609812
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IBA
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	NAS	18331822
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005742	Component	Mitochondrial outer membrane translocase complex	ISS
GO:0005742	Component	Mitochondrial outer membrane translocase complex	TAS	15644312
GO:0006626	Process	Protein targeting to mitochondrion	IEA
GO:0006626	Process	Protein targeting to mitochondrion	ISS
GO:0008320	Function	Protein transmembrane transporter activity	IBA
GO:0008320	Function	Protein transmembrane transporter activity	ISS
GO:0008320	Function	Protein transmembrane transporter activity	TAS	15644312
GO:0009299	Process	MRNA transcription	IDA	9891032
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0030150	Process	Protein import into mitochondrial matrix	IBA
GO:0030150	Process	Protein import into mitochondrial matrix	ISS
GO:0030150	Process	Protein import into mitochondrial matrix	TAS	15644312
GO:0030943	Function	Mitochondrion targeting sequence binding	IBA
GO:0030943	Function	Mitochondrion targeting sequence binding	ISS
GO:0031966	Component	Mitochondrial membrane	IDA	20628368
GO:0032728	Process	Positive regulation of interferon-beta production	IDA	20628368
GO:0042981	Process	Regulation of apoptotic process	IDA	25609812
GO:0045039	Process	Protein insertion into mitochondrial inner membrane	IBA
GO:0045039	Process	Protein insertion into mitochondrial inner membrane	ISS
GO:0045040	Process	Protein insertion into mitochondrial outer membrane	NAS	18331822
GO:0060090	Function	Molecular adaptor activity	IDA	20628368
GO:0061052	Process	Negative regulation of cell growth involved in cardiac muscle cell development	IEA
GO:0070062	Component	Extracellular exosome	HDA	18570454
GO:0097068	Process	Response to thyroxine	IEA
GO:0098586	Process	Cellular response to virus	IDA	25609812
GO:0140374	Process	Antiviral innate immune response	IDA	9891032, 14703513, 18984593
GO:0140596	Component	TOM complex	NAS	18331822
GO:1903955	Process	Positive regulation of protein targeting to mitochondrion	IEA

MIM	HGNC	e!Ensembl
606081	11985	ENSG00000154174

O94826

Protein name

Mitochondrial import receptor subunit TOM70 (Mitochondrial precursor proteins import receptor) (Translocase of outer membrane 70 kDa subunit) (Translocase of outer mitochondrial membrane protein 70)

Protein function

Acts as a receptor of the preprotein translocase complex of the outer mitochondrial membrane (TOM complex) (PubMed:12526792). Recognizes and mediates the translocation of mitochondrial preproteins from the cytosol into the mitochondria in a chap

PDB

7DHG , 7KDT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00515	TPR_1	114 → 147	Tetratricopeptide repeat	Repeat
PF13181	TPR_8	329 → 362	Tetratricopeptide repeat	Repeat
PF13181	TPR_8	401 → 434	Tetratricopeptide repeat	Repeat
PF13181	TPR_8	476 → 509	Tetratricopeptide repeat	Repeat
PF13181	TPR_8	547 → 578	Tetratricopeptide repeat	Repeat

Sequence

MAASKPVEAAVVAAAVPSSGSGVGGGGTAGPGTGGLPRWQLALAVGAPLLLGAGAIYLWS
RQQRRREARGRGDASGLKRNSERKTPEGRASPAPGSGHPEGPGAHLDMNSLDRAQAAKNK
GNKYFKAGKYEQAIQCYTEAISLCPTEKNVDLSTFYQNRAAAFEQLQKWKEVAQDCTKAV
ELNPKYVKALFRRAKAHEKLDNKKECLEDVTAVCILEGFQNQQSMLLADKVLKLLGKEKA
KEKYKNREPLMPSPQFIKSYFSSFTDDIISQPMLKGEKSDEDKDKEGEALEVKENSGYLK
AKQYMEEENYDKIISECSKEIDAEGKYMAEALLLRATFYLLIGNANAAKPDLDKVISLKE
ANVKLRANALIKRGSMYMQQQQPLLSTQDFNMAADIDPQNADVYHHRGQLKILLDQVEEA
VADFDECIRLRPESALAQAQKCFALYRQAYTGNNSSQIQAAMKGFEEVIKKFPRCAEGYA
LYAQALTDQQQFGKADEMYDKCIDLEPDNATTYVHKGLLQLQWKQDLDRGLELISKAIEI
DNKCDFAYETMGTIEVQRGNMEKAIDMFNKAINLAKSEMEMAHLYSLCDAAHAQTEVAKK
YGLKPPTL

Sequence length

608

Interactions

View interactions

	KEGG		Reactome
	Mitophagy - animal		Pink/Parkin Mediated Mitophagy Ub-specific processing proteases

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COMBINED OXIDATIVE PHOSPHORYLATION DEFICIENCY	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKODYSTROPHY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NERVOUS SYSTEM DISORDER	—	Disgenet, GenCC Disgenet, GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOMM70-related neurodevelopmental disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (14)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Ataxia	Ataxia	Pubtator	32356556	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23172368	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36185995	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystonia	Dystonia	Pubtator	32356556	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	21412788	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	10582581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	32356556	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	27706848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28724549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	32356556	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	32356556	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	25022898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	24149440	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prion Diseases	Prion disease	Pubtator	32356556	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TOMM70 (translocase of outer mitochondrial membrane 70)