Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9846
Gene name	GRB2 associated binding protein 2
Gene symbol	GAB2
Synonyms (NCBI Gene)	-
Chromosome	11
Chromosome location	11q14.1
Summary	This gene is a member of the GRB2-associated binding protein (GAB) gene family. These proteins contain pleckstrin homology (PH) domain, and bind SHP2 tyrosine phosphatase and GRB2 adapter protein. They act as adapters for transmitting various signals in r

244

Show/Hide all (244)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006161	hsa-let-7g-5p	Luciferase reporter assayMicroarrayWestern blot	21868760
MIRT006161	hsa-let-7g-5p	Luciferase reporter assayMicroarrayWestern blot	21868760
MIRT006161	hsa-let-7g-5p	Luciferase reporter assayMicroarrayWestern blot	21868760
MIRT006161	hsa-let-7g-5p	Luciferase reporter assayMicroarrayWestern blot	21868760
MIRT006161	hsa-let-7g-5p	Luciferase reporter assayMicroarrayWestern blot	21868760
MIRT006161	hsa-let-7g-5p	Luciferase reporter assayMicroarrayWestern blot	21868760
MIRT017199	hsa-miR-335-5p	Microarray	18185580
MIRT024466	hsa-miR-215-5p	Microarray	19074876
MIRT026255	hsa-miR-192-5p	Microarray	19074876
MIRT710537	hsa-miR-6777-3p	HITS-CLIP	19536157
MIRT710536	hsa-miR-6849-3p	HITS-CLIP	19536157
MIRT710535	hsa-miR-6512-3p	HITS-CLIP	19536157
MIRT710534	hsa-miR-6720-5p	HITS-CLIP	19536157
MIRT551196	hsa-miR-186-5p	PAR-CLIP	21572407
MIRT551197	hsa-miR-6507-5p	PAR-CLIP	21572407
MIRT551195	hsa-miR-3529-3p	PAR-CLIP	21572407
MIRT440597	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440597	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT710537	hsa-miR-6777-3p	HITS-CLIP	19536157
MIRT710536	hsa-miR-6849-3p	HITS-CLIP	19536157
MIRT710535	hsa-miR-6512-3p	HITS-CLIP	19536157
MIRT710534	hsa-miR-6720-5p	HITS-CLIP	19536157
MIRT551196	hsa-miR-186-5p	PAR-CLIP	21572407
MIRT551197	hsa-miR-6507-5p	PAR-CLIP	21572407
MIRT551195	hsa-miR-3529-3p	PAR-CLIP	21572407
MIRT1009226	hsa-miR-1193	CLIP-seq
MIRT1009227	hsa-miR-1200	CLIP-seq
MIRT1009228	hsa-miR-1225-3p	CLIP-seq
MIRT1009229	hsa-miR-1229	CLIP-seq
MIRT1009230	hsa-miR-1262	CLIP-seq
MIRT1009231	hsa-miR-1293	CLIP-seq
MIRT1009232	hsa-miR-129-3p	CLIP-seq
MIRT1009233	hsa-miR-1470	CLIP-seq
MIRT1009234	hsa-miR-149	CLIP-seq
MIRT1009235	hsa-miR-18a	CLIP-seq
MIRT1009236	hsa-miR-18b	CLIP-seq
MIRT1009237	hsa-miR-2355-5p	CLIP-seq
MIRT1009238	hsa-miR-24	CLIP-seq
MIRT1009239	hsa-miR-3064-5p	CLIP-seq
MIRT1009240	hsa-miR-3065-3p	CLIP-seq
MIRT1009241	hsa-miR-3126-3p	CLIP-seq
MIRT1009242	hsa-miR-3129-3p	CLIP-seq
MIRT1009243	hsa-miR-3165	CLIP-seq
MIRT1009244	hsa-miR-3175	CLIP-seq
MIRT1009245	hsa-miR-3185	CLIP-seq
MIRT1009246	hsa-miR-3529	CLIP-seq
MIRT1009247	hsa-miR-3612	CLIP-seq
MIRT1009248	hsa-miR-3614-5p	CLIP-seq
MIRT1009249	hsa-miR-3620	CLIP-seq
MIRT1009250	hsa-miR-3689a-3p	CLIP-seq
MIRT1009251	hsa-miR-3689c	CLIP-seq
MIRT1009252	hsa-miR-3689d	CLIP-seq
MIRT1009253	hsa-miR-3691-5p	CLIP-seq
MIRT1009254	hsa-miR-379	CLIP-seq
MIRT1009255	hsa-miR-3938	CLIP-seq
MIRT1009256	hsa-miR-4284	CLIP-seq
MIRT1009257	hsa-miR-4286	CLIP-seq
MIRT1009258	hsa-miR-4323	CLIP-seq
MIRT1009259	hsa-miR-4443	CLIP-seq
MIRT1009260	hsa-miR-4451	CLIP-seq
MIRT1009261	hsa-miR-4469	CLIP-seq
MIRT1009262	hsa-miR-4483	CLIP-seq
MIRT1009263	hsa-miR-4487	CLIP-seq
MIRT1009264	hsa-miR-4490	CLIP-seq
MIRT1009265	hsa-miR-4504	CLIP-seq
MIRT1009266	hsa-miR-4509	CLIP-seq
MIRT1009267	hsa-miR-4633-3p	CLIP-seq
MIRT1009268	hsa-miR-4650-3p	CLIP-seq
MIRT1009269	hsa-miR-4667-3p	CLIP-seq
MIRT1009270	hsa-miR-4701-3p	CLIP-seq
MIRT1009271	hsa-miR-4722-3p	CLIP-seq
MIRT1009272	hsa-miR-4728-5p	CLIP-seq
MIRT1009273	hsa-miR-4735-3p	CLIP-seq
MIRT1009274	hsa-miR-4744	CLIP-seq
MIRT1009275	hsa-miR-4774-5p	CLIP-seq
MIRT1009276	hsa-miR-4794	CLIP-seq
MIRT1009277	hsa-miR-4795-5p	CLIP-seq
MIRT1009278	hsa-miR-634	CLIP-seq
MIRT1009279	hsa-miR-642a	CLIP-seq
MIRT1009280	hsa-miR-650	CLIP-seq
MIRT1009281	hsa-miR-124	CLIP-seq
MIRT1009230	hsa-miR-1262	CLIP-seq
MIRT1009282	hsa-miR-140-3p	CLIP-seq
MIRT1009283	hsa-miR-181a	CLIP-seq
MIRT1009284	hsa-miR-181b	CLIP-seq
MIRT1009285	hsa-miR-181c	CLIP-seq
MIRT1009286	hsa-miR-181d	CLIP-seq
MIRT1009287	hsa-miR-197	CLIP-seq
MIRT1009288	hsa-miR-23a	CLIP-seq
MIRT1009289	hsa-miR-23b	CLIP-seq
MIRT1009290	hsa-miR-23c	CLIP-seq
MIRT1009291	hsa-miR-3120-3p	CLIP-seq
MIRT1009292	hsa-miR-3120-5p	CLIP-seq
MIRT1009293	hsa-miR-3127-5p	CLIP-seq
MIRT1009245	hsa-miR-3185	CLIP-seq
MIRT1009294	hsa-miR-346	CLIP-seq
MIRT1009295	hsa-miR-3714	CLIP-seq
MIRT1009296	hsa-miR-3910	CLIP-seq
MIRT1009297	hsa-miR-3918	CLIP-seq
MIRT1009298	hsa-miR-3977	CLIP-seq
MIRT1009299	hsa-miR-412	CLIP-seq
MIRT1009300	hsa-miR-4262	CLIP-seq
MIRT1009301	hsa-miR-4288	CLIP-seq
MIRT1009302	hsa-miR-4446-3p	CLIP-seq
MIRT1009303	hsa-miR-4477b	CLIP-seq
MIRT1009263	hsa-miR-4487	CLIP-seq
MIRT1009304	hsa-miR-4492	CLIP-seq
MIRT1009305	hsa-miR-4498	CLIP-seq
MIRT1009306	hsa-miR-4505	CLIP-seq
MIRT1009267	hsa-miR-4633-3p	CLIP-seq
MIRT1009270	hsa-miR-4701-3p	CLIP-seq
MIRT1009277	hsa-miR-4795-5p	CLIP-seq
MIRT1009307	hsa-miR-486-5p	CLIP-seq
MIRT1009308	hsa-miR-506	CLIP-seq
MIRT1009309	hsa-miR-545	CLIP-seq
MIRT1009310	hsa-miR-548p	CLIP-seq
MIRT1009311	hsa-miR-592	CLIP-seq
MIRT1009312	hsa-miR-597	CLIP-seq
MIRT1009313	hsa-miR-632	CLIP-seq
MIRT1009314	hsa-miR-762	CLIP-seq
MIRT1549113	hsa-miR-1301	CLIP-seq
MIRT1009245	hsa-miR-3185	CLIP-seq
MIRT1549114	hsa-miR-3944-5p	CLIP-seq
MIRT1549115	hsa-miR-4481	CLIP-seq
MIRT1549116	hsa-miR-4635	CLIP-seq
MIRT1549117	hsa-miR-4660	CLIP-seq
MIRT1549118	hsa-miR-4709-3p	CLIP-seq
MIRT1549119	hsa-miR-4745-5p	CLIP-seq
MIRT1549120	hsa-miR-5047	CLIP-seq
MIRT1999034	hsa-miR-1178	CLIP-seq
MIRT1999035	hsa-miR-1228	CLIP-seq
MIRT1999036	hsa-miR-1252	CLIP-seq
MIRT1999037	hsa-miR-1254	CLIP-seq
MIRT1009230	hsa-miR-1262	CLIP-seq
MIRT1999038	hsa-miR-1285	CLIP-seq
MIRT1009234	hsa-miR-149	CLIP-seq
MIRT1999039	hsa-miR-1913	CLIP-seq
MIRT1999040	hsa-miR-1915	CLIP-seq
MIRT1009287	hsa-miR-197	CLIP-seq
MIRT1999041	hsa-miR-2110	CLIP-seq
MIRT1999042	hsa-miR-219-5p	CLIP-seq
MIRT1999043	hsa-miR-2277-3p	CLIP-seq
MIRT1999044	hsa-miR-2355-3p	CLIP-seq
MIRT1999045	hsa-miR-296-5p	CLIP-seq
MIRT1009239	hsa-miR-3064-5p	CLIP-seq
MIRT1999046	hsa-miR-3115	CLIP-seq
MIRT1999047	hsa-miR-3116	CLIP-seq
MIRT1009293	hsa-miR-3127-5p	CLIP-seq
MIRT1999048	hsa-miR-3160-5p	CLIP-seq
MIRT1999049	hsa-miR-3187-5p	CLIP-seq
MIRT1999050	hsa-miR-3202	CLIP-seq
MIRT1999051	hsa-miR-324-3p	CLIP-seq
MIRT1999052	hsa-miR-331-3p	CLIP-seq
MIRT1999053	hsa-miR-3667-3p	CLIP-seq
MIRT1999054	hsa-miR-3675-3p	CLIP-seq
MIRT1009250	hsa-miR-3689a-3p	CLIP-seq
MIRT1009251	hsa-miR-3689c	CLIP-seq
MIRT1999055	hsa-miR-378g	CLIP-seq
MIRT1999056	hsa-miR-3920	CLIP-seq
MIRT1009298	hsa-miR-3977	CLIP-seq
MIRT1999057	hsa-miR-4271	CLIP-seq
MIRT1999058	hsa-miR-4289	CLIP-seq
MIRT1999059	hsa-miR-4290	CLIP-seq
MIRT1999060	hsa-miR-4445	CLIP-seq
MIRT1999061	hsa-miR-4446-5p	CLIP-seq
MIRT1999062	hsa-miR-4474-3p	CLIP-seq
MIRT1999063	hsa-miR-4486	CLIP-seq
MIRT1999064	hsa-miR-4684-5p	CLIP-seq
MIRT1999065	hsa-miR-4694-3p	CLIP-seq
MIRT1009270	hsa-miR-4701-3p	CLIP-seq
MIRT1999066	hsa-miR-4709-5p	CLIP-seq
MIRT1999067	hsa-miR-4717-3p	CLIP-seq
MIRT1009271	hsa-miR-4722-3p	CLIP-seq
MIRT1999068	hsa-miR-4725-3p	CLIP-seq
MIRT1999069	hsa-miR-4726-3p	CLIP-seq
MIRT1009272	hsa-miR-4728-5p	CLIP-seq
MIRT1999070	hsa-miR-4747-5p	CLIP-seq
MIRT1999071	hsa-miR-4755-5p	CLIP-seq
MIRT1999072	hsa-miR-4762-3p	CLIP-seq
MIRT1999073	hsa-miR-4782-3p	CLIP-seq
MIRT1999074	hsa-miR-4793-5p	CLIP-seq
MIRT1009276	hsa-miR-4794	CLIP-seq
MIRT1999075	hsa-miR-485-5p	CLIP-seq
MIRT1999076	hsa-miR-498	CLIP-seq
MIRT1999077	hsa-miR-508-3p	CLIP-seq
MIRT1999078	hsa-miR-522	CLIP-seq
MIRT1999079	hsa-miR-590-3p	CLIP-seq
MIRT1999080	hsa-miR-612	CLIP-seq
MIRT1999081	hsa-miR-622	CLIP-seq
MIRT1009279	hsa-miR-642a	CLIP-seq
MIRT1999082	hsa-miR-676	CLIP-seq
MIRT2232747	hsa-miR-4738-3p	CLIP-seq
MIRT1999037	hsa-miR-1254	CLIP-seq
MIRT2232748	hsa-miR-146b-3p	CLIP-seq
MIRT1999043	hsa-miR-2277-3p	CLIP-seq
MIRT1999044	hsa-miR-2355-3p	CLIP-seq
MIRT1999047	hsa-miR-3116	CLIP-seq
MIRT1999048	hsa-miR-3160-5p	CLIP-seq
MIRT2232749	hsa-miR-3173-5p	CLIP-seq
MIRT2232750	hsa-miR-3591-3p	CLIP-seq
MIRT2232751	hsa-miR-370	CLIP-seq
MIRT2232752	hsa-miR-4279	CLIP-seq
MIRT1999067	hsa-miR-4717-3p	CLIP-seq
MIRT1009271	hsa-miR-4722-3p	CLIP-seq
MIRT1999082	hsa-miR-676	CLIP-seq
MIRT2232753	hsa-miR-874	CLIP-seq
MIRT1999037	hsa-miR-1254	CLIP-seq
MIRT1999043	hsa-miR-2277-3p	CLIP-seq
MIRT1999044	hsa-miR-2355-3p	CLIP-seq
MIRT1999047	hsa-miR-3116	CLIP-seq
MIRT1999048	hsa-miR-3160-5p	CLIP-seq
MIRT2388317	hsa-miR-3182	CLIP-seq
MIRT2388318	hsa-miR-3187-3p	CLIP-seq
MIRT2232752	hsa-miR-4279	CLIP-seq
MIRT1009263	hsa-miR-4487	CLIP-seq
MIRT2388319	hsa-miR-4529-5p	CLIP-seq
MIRT1999067	hsa-miR-4717-3p	CLIP-seq
MIRT1009271	hsa-miR-4722-3p	CLIP-seq
MIRT2388320	hsa-miR-548c-3p	CLIP-seq
MIRT1999082	hsa-miR-676	CLIP-seq
MIRT2388321	hsa-miR-885-5p	CLIP-seq
MIRT2437340	hsa-miR-298	CLIP-seq
MIRT2437341	hsa-miR-3200-3p	CLIP-seq
MIRT2437342	hsa-miR-3678-3p	CLIP-seq
MIRT1009263	hsa-miR-4487	CLIP-seq
MIRT1009267	hsa-miR-4633-3p	CLIP-seq
MIRT1009277	hsa-miR-4795-5p	CLIP-seq
MIRT1009234	hsa-miR-149	CLIP-seq
MIRT1999039	hsa-miR-1913	CLIP-seq
MIRT1009239	hsa-miR-3064-5p	CLIP-seq
MIRT1999051	hsa-miR-324-3p	CLIP-seq
MIRT1999059	hsa-miR-4290	CLIP-seq
MIRT1009276	hsa-miR-4794	CLIP-seq
MIRT1009234	hsa-miR-149	CLIP-seq
MIRT1999039	hsa-miR-1913	CLIP-seq
MIRT1009239	hsa-miR-3064-5p	CLIP-seq
MIRT1999051	hsa-miR-324-3p	CLIP-seq
MIRT1999052	hsa-miR-331-3p	CLIP-seq
MIRT1999059	hsa-miR-4290	CLIP-seq
MIRT2681275	hsa-miR-4493	CLIP-seq
MIRT2681276	hsa-miR-4786-5p	CLIP-seq
MIRT1009276	hsa-miR-4794	CLIP-seq
MIRT1999081	hsa-miR-622	CLIP-seq
MIRT2681277	hsa-miR-769-5p	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005068	Function	Transmembrane receptor protein tyrosine kinase adaptor activity	IBA
GO:0005068	Function	Transmembrane receptor protein tyrosine kinase adaptor activity	IDA	19172738
GO:0005515	Function	Protein binding	IPI	15170389, 15750601, 16253990, 19172738, 19380743, 19523899, 20936779, 21706016, 25416956, 31515488, 31585087, 31980649, 32296183, 32814053, 33961781, 36931259
GO:0005547	Function	Phosphatidylinositol-3,4,5-trisphosphate binding	ISS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	19172738
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	19172738
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	19172738
GO:0016020	Component	Membrane	IEA
GO:0030316	Process	Osteoclast differentiation	IMP	15750601
GO:0043306	Process	Positive regulation of mast cell degranulation	ISS
GO:0043325	Function	Phosphatidylinositol-3,4-bisphosphate binding	ISS
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0045121	Component	Membrane raft	IEA
GO:0045121	Component	Membrane raft	ISS

MIM	HGNC	e!Ensembl
606203	14458	ENSG00000033327

Q9UQC2

Protein name

GRB2-associated-binding protein 2 (GRB2-associated binder 2) (Growth factor receptor bound protein 2-associated protein 2) (pp100)

Protein function

Adapter protein which acts downstream of several membrane receptors including cytokine, antigen, hormone, cell matrix and growth factor receptors to regulate multiple signaling pathways. Regulates osteoclast differentiation mediating the TNFRSF1

PDB

2VWF , 2W0Z , 5EWZ , 5EXA , 6Y3R , 6Y3S , 6ZVB , 6ZVC , 6ZVD , 6ZVE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00169	PH	7 → 117	PH domain	Domain

Sequence

MSGGGDVVCTGWLRKSPPEKKLRRYAWKKRWFILRSGRMSGDPDVLEYYKNDHSKKPLRI
INLNFCEQVDAGLTFNKKELQDSFVFDIKTSERTFYLVAETEEDMNKWVQSICQICGFNQ
AEESTDSLRNVSSAGHGPRSSPAELSSSSQHLLRERKSSAPSHSSQPTLFTFEPPVSNHM
QPTLSTSAPQEYLYLHQCISRRAENARSASFSQGTRASFLMRSDTAVQKLAQGNGHCVNG
ISGQVHGFYSLPKPSRHNTEFRDSTYDLPRSLASHGHTKGSLTGSETDNEDVYTFKTPSN
TLCREFGDLLVDNMDVPATPLSAYQIPRTFTLDKNHNAMTVATPGDSAIAPPPRPPKPSQ
AETPRWGSPQQRPPISENSRSVAATIPRRNTLPAMDNSRLHRASSCETYEYPQRGGESAG
RSAESMSDGVGSFLPGKMIVGRSDSTNSEDNYVPMNPGSSTLLAMERAGDNSQSVYIPMS
PGAHHFDSLGYPSTTLPVHRGPSRGSEIQPPPVNRNLKPDRKAKPTPLDLRNNTVIDELP
FKSPITKSWSRANHTFNSSSSQYCRPISTQSITSTDSGDSEENYVPMQNPVSASPVPSGT
NSPAPKKSTGSVDYLALDFQPSSPSPHRKPSTSSVTSDEKVDYVQVDKEKTQALQNTMQE
WTDVRQSSEPSKGAKL

Sequence length

676

Interactions

View interactions

	KEGG		Reactome
	Ras signaling pathway Sphingolipid signaling pathway Phospholipase D signaling pathway Osteoclast differentiation Fc epsilon RI signaling pathway Fc gamma R-mediated phagocytosis Chronic myeloid leukemia		PI3K Cascade Signaling by SCF-KIT Signaling by cytosolic FGFR1 fusion mutants Role of LAT2/NTAL/LAB on calcium mobilization RET signaling Interleukin receptor SHC signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTINODULAR GOITER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TESTICULAR CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TESTICULAR GERM CELL TUMOR	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (107)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	17553421, 19204163, 19262956, 20568290, 20634593, 20888920, 21497199, 22273362, 22856364, 23525328, 23724096, 25853819, 26680604, 28650998, 34103633	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	17553421, 18854865, 19118819, 19924507, 20888920, 21108942, 21132329, 22273362, 22856364, 23724096, 25853819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	17553421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASDB_DG	17553421, 21460841		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28558797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	37914735	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	29207374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	29207374	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28842424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	22856364	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12140767, 16369543, 19881546, 20087860, 30326469, 31002135, 31698596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16253990, 19838208, 21118992, 21552417, 26126114, 31002135, 31698596	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	29880043	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	16253990	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27026230, 36421826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22859374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	28558797	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	28412750	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	39354528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24385586, 25852062, 26657155, 30093110, 30755818, 31194976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	39294340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	30836997	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	31102422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	22859374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	GWASCAT_DG	30940143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25029990, 26045784, 26354435, 26754532, 28420432, 29781037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	25029990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26045784	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28412750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	28202507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	32619126	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	32619126	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	24327320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	24327320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	40140746	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	28640357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	27282405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	36421826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	27282405, 28842424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	28295819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	27035789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	27035789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23231021, 25598421, 27035789, 28000880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	30206415	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	40140746	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	31739284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	26657155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	26754532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	27840422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	20697350	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	27840422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	16736498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	18697750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28842424, 30720118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21552417	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26045784	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	33883344	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12140767, 16253990, 16369543, 19881546, 20087860, 30326469, 31002135, 31698596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	28202507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22859374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	24385586, 25852062, 26657155, 30093110, 30755818, 31194976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17804714, 19342374, 21118992, 21996746, 22751113, 22871571, 23231021, 23401857, 24385586, 26045784, 26617767, 27035789, 28791340, 29137268, 29207374, 30093110, 30326469, 31194976 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	28960030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12140767, 16369543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16369543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	19342374		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19342374, 19509136, 22926523		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	19342374, 19509136, 21552417, 30657954, 33067454	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	CTD_human_DG	22535842		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	BEFREE	15010462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	15010462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	15010462	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	LHGDN	16736498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	16278304, 16818614, 22858987, 26912052		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16369543, 16736498, 19342374, 20087860, 26617767, 26657155, 26754532, 28329685, 28420432, 28842424, 29781037, 29880043, 30326469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28329685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26617767, 30127957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	20087860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	27282405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopetrosis	Osteopetrosis	BEFREE	15750601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29422967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	30093110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	32619126	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	18314909		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	21996746, 24385586, 25852062, 26657155, 30755818, 31194976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	21996746, 37085900	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	28558797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	24248418	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	32522441	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	31030001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28687632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Prolapse	Rectal Prolapse	BEFREE	30936879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28412750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	15973463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	31739284	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	37653517	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	28960030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	28960030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	27282405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	31739284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31814524	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	26503584		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	GWASCAT_DG	26503584		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Uveal Melanoma	BEFREE	28791340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	28791340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	37321605	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	37321605	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

GAB2 (GRB2 associated binding protein 2)