ELMO1 (engulfment and cell motility 1)

Gene

• Entrez ID: 9844
• Gene name: Engulfment and cell motility 1
• Gene symbol: ELMO1
• Synonyms (NCBI Gene): CED-12, CED12, ELMO-1
• Chromosome: 7
• Chromosome location: 7p14.2-p14.1
• Summary: This gene encodes a member of the engulfment and cell motility protein family. These proteins interact with dedicator of cytokinesis proteins to promote phagocytosis and cell migration. Increased expression of this gene and dedicator of cytokinesis 1 may

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT714044	hsa-miR-21-3p	HITS-CLIP	19536157
MIRT714043	hsa-miR-3591-3p	HITS-CLIP	19536157
MIRT714042	hsa-miR-1323	HITS-CLIP	19536157
MIRT714041	hsa-miR-548o-3p	HITS-CLIP	19536157
MIRT714040	hsa-miR-1226-3p	HITS-CLIP	19536157
MIRT714039	hsa-miR-6736-3p	HITS-CLIP	19536157
MIRT714038	hsa-miR-4267	HITS-CLIP	19536157
MIRT714037	hsa-miR-6793-3p	HITS-CLIP	19536157
MIRT727779	hsa-miR-27a-3p	HITS-CLIP	22473208
MIRT727778	hsa-miR-27b-3p	HITS-CLIP	22473208
MIRT714044	hsa-miR-21-3p	HITS-CLIP	19536157
MIRT714043	hsa-miR-3591-3p	HITS-CLIP	19536157
MIRT714042	hsa-miR-1323	HITS-CLIP	19536157
MIRT714041	hsa-miR-548o-3p	HITS-CLIP	19536157
MIRT714040	hsa-miR-1226-3p	HITS-CLIP	19536157
MIRT714039	hsa-miR-6736-3p	HITS-CLIP	19536157
MIRT714038	hsa-miR-4267	HITS-CLIP	19536157
MIRT714037	hsa-miR-6793-3p	HITS-CLIP	19536157
MIRT960811	hsa-miR-1293	CLIP-seq
MIRT960812	hsa-miR-3185	CLIP-seq
MIRT960813	hsa-miR-3646	CLIP-seq
MIRT960814	hsa-miR-3714	CLIP-seq
MIRT960815	hsa-miR-4483	CLIP-seq
MIRT960816	hsa-miR-1202	CLIP-seq
MIRT960817	hsa-miR-1237	CLIP-seq
MIRT960818	hsa-miR-1260	CLIP-seq
MIRT960819	hsa-miR-1260b	CLIP-seq
MIRT960820	hsa-miR-130a	CLIP-seq
MIRT960821	hsa-miR-130b	CLIP-seq
MIRT960822	hsa-miR-148a	CLIP-seq
MIRT960823	hsa-miR-148b	CLIP-seq
MIRT960824	hsa-miR-152	CLIP-seq
MIRT960825	hsa-miR-1825	CLIP-seq
MIRT960826	hsa-miR-185	CLIP-seq
MIRT960827	hsa-miR-188-3p	CLIP-seq
MIRT960828	hsa-miR-1915	CLIP-seq
MIRT960829	hsa-miR-199a-5p	CLIP-seq
MIRT960830	hsa-miR-199b-5p	CLIP-seq
MIRT960831	hsa-miR-19a	CLIP-seq
MIRT960832	hsa-miR-19b	CLIP-seq
MIRT960833	hsa-miR-301a	CLIP-seq
MIRT960834	hsa-miR-301b	CLIP-seq
MIRT960835	hsa-miR-3074-5p	CLIP-seq
MIRT960836	hsa-miR-3156-3p	CLIP-seq
MIRT960837	hsa-miR-3194-5p	CLIP-seq
MIRT960838	hsa-miR-365	CLIP-seq
MIRT960839	hsa-miR-3653	CLIP-seq
MIRT960840	hsa-miR-3658	CLIP-seq
MIRT960841	hsa-miR-3660	CLIP-seq
MIRT960842	hsa-miR-3666	CLIP-seq
MIRT960843	hsa-miR-3913-3p	CLIP-seq
MIRT960844	hsa-miR-3925-3p	CLIP-seq
MIRT960845	hsa-miR-3972	CLIP-seq
MIRT960846	hsa-miR-4256	CLIP-seq
MIRT960847	hsa-miR-4270	CLIP-seq
MIRT960848	hsa-miR-4295	CLIP-seq
MIRT960849	hsa-miR-4306	CLIP-seq
MIRT960850	hsa-miR-4434	CLIP-seq
MIRT960851	hsa-miR-4441	CLIP-seq
MIRT960852	hsa-miR-4516	CLIP-seq
MIRT960853	hsa-miR-4517	CLIP-seq
MIRT960854	hsa-miR-4519	CLIP-seq
MIRT960855	hsa-miR-451b	CLIP-seq
MIRT960856	hsa-miR-4526	CLIP-seq
MIRT960857	hsa-miR-4535	CLIP-seq
MIRT960858	hsa-miR-454	CLIP-seq
MIRT960859	hsa-miR-4644	CLIP-seq
MIRT960860	hsa-miR-4656	CLIP-seq
MIRT960861	hsa-miR-4688	CLIP-seq
MIRT960862	hsa-miR-4726-3p	CLIP-seq
MIRT960863	hsa-miR-4766-5p	CLIP-seq
MIRT960864	hsa-miR-4768-3p	CLIP-seq
MIRT960865	hsa-miR-4776-5p	CLIP-seq
MIRT960866	hsa-miR-489	CLIP-seq
MIRT960867	hsa-miR-548ag	CLIP-seq
MIRT960868	hsa-miR-548ai	CLIP-seq
MIRT960869	hsa-miR-665	CLIP-seq
MIRT960870	hsa-miR-711	CLIP-seq
MIRT960835	hsa-miR-3074-5p	CLIP-seq
MIRT1984759	hsa-miR-3179	CLIP-seq
MIRT1984760	hsa-miR-3685	CLIP-seq
MIRT1984761	hsa-miR-4299	CLIP-seq
MIRT1984762	hsa-miR-548q	CLIP-seq
MIRT1984763	hsa-miR-622	CLIP-seq
MIRT1984760	hsa-miR-3685	CLIP-seq
MIRT1984763	hsa-miR-622	CLIP-seq
MIRT2522924	hsa-miR-1294	CLIP-seq
MIRT2522925	hsa-miR-2115	CLIP-seq
MIRT2522926	hsa-miR-218	CLIP-seq
MIRT2522927	hsa-miR-3692	CLIP-seq
MIRT2522928	hsa-miR-4316	CLIP-seq
MIRT2522929	hsa-miR-4677-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IDA	12134158
GO:0005515	Function	Protein binding	IPI	12029088, 12134158, 12879077, 15247908, 15723800, 17960134, 18768751, 24567399, 25416956, 28514442, 30853625, 31515488, 33513601, 33961781
GO:0005737	Component	Cytoplasm	IDA	11595183
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	11595183
GO:0005886	Component	Plasma membrane	IEA
GO:0006909	Process	Phagocytosis	IEA
GO:0006909	Process	Phagocytosis	IEA
GO:0006911	Process	Phagocytosis, engulfment	IGI	11595183
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	NAS	11595183
GO:0007015	Process	Actin filament organization	IBA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016601	Process	Rac protein signal transduction	IGI	11595183
GO:0017124	Function	SH3 domain binding	IEA
GO:0017124	Function	SH3 domain binding	IPI	12029088
GO:0030029	Process	Actin filament-based process	IEA
GO:0030036	Process	Actin cytoskeleton organization	IGI	11595183
GO:0032045	Component	Guanyl-nucleotide exchange factor complex	IBA
GO:0032045	Component	Guanyl-nucleotide exchange factor complex	IDA	12134158
GO:0032045	Component	Guanyl-nucleotide exchange factor complex	IEA
GO:0048870	Process	Cell motility	IBA
GO:0048870	Process	Cell motility	IGI	11595183
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0150052	Process	Regulation of postsynapse assembly	IEA

Other IDs

• MIM: 606420
• HGNC: 16286
• e!Ensembl: ENSG00000155849

Protein

• UniProt ID: Q92556
• Protein name: Engulfment and cell motility protein 1 (Protein ced-12 homolog)
• Protein function: Involved in cytoskeletal rearrangements required for phagocytosis of apoptotic cells and cell motility. Acts in association with DOCK1 and CRK. Was initially proposed to be required in complex with DOCK1 to activate Rac Rho small GTPases. May en
• PDB: 2RQR, 2VSZ, 3A98, 6JPP, 6TGB, 6TGC, 7DPA, 7Y4A, 8JHK, 8XM7, 8ZJ2, 8ZJI, 8ZJJ, 8ZJK, 8ZJL, 8ZJM
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF11841	DUF3361	115 → 280	Domain of unknown function (DUF3361)	Family
  PF04727	ELMO_CED12	303 → 481	ELMO/CED-12 family	Family
  PF16457	PH_12	548 → 674	Pleckstrin homology domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed, with a higher expression in the spleen and placenta.
• Sequence:

  MPPPADIVKVAIEWPGAYPKLMEIDQKKPLSAIIKEVCDGWSLANHEYFALQHADSSNFY
  ITEKNRNEIKNGTILRLTTSPAQNAQQLHERIQSSSMDAKLEALKDLASLSRDVTFAQEF
  INLDGISLLTQMVESGTERYQKLQKIMKPCFGDMLSFTLTAFVELMDHGIVSWDTFSVAF
  IKKIASFVNKSAIDISILQRSLAILESMVLNSHDLYQKVAQEITIGQLIPHLQGSDQEIQ
  TYTIAVINALFLKAPDERRQEMANILAQKQLRSIILTHVIRAQRAINNEMAHQLYVLQVL
  TFNLLEDRMMTKMDPQDQAQRDIIFELRRIAFDAESEPNNSSGSMEKRKSMYTRDYKKLG
  FINHVNPAMDFTQTPPGMLALDNMLYFAKHHQDAYIRIVLENSSREDKHECPFGRSSIEL
  TKMLCEILKVGELPSETCNDFHPMFFTHDRSFEEFFCICIQLLNKTWKEMRATSEDFNKV
  MQVVKEQVMRALTTKPSSLDQFKSKLQNLSYTEILKIRQSERMNQEDFQSRPILELKEKI
  QPEILELIKQQRLNRLVEGTCFRKLNARRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVP
  HDSLQDKLPVADIKAVVTGKDCPHMKEKGALKQNKEVLELAFSILYDSNCQLNFIAPDKH
  EYCIWTDGLNALLGKDMMSDLTRNDLDTLLSMEIKLRLLDLENIQIPDAPPPIPKEPSNY
  DFVYDCN

• Sequence length: 727

Pathways

KEGG:

Chemokine signaling pathway
Efferocytosis
Bacterial invasion of epithelial cells
Shigellosis
Salmonella infection
Yersinia infection

Reactome:

Nef and signal transduction
Regulation of actin dynamics for phagocytic cup formation
VEGFA-VEGFR2 Pathway
PTK6 Regulates RHO GTPases, RAS GTPase and MAP kinases
FCGR3A-mediated phagocytosis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTONOMIC NERVOUS SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY LIVER CIRRHOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUPUYTREN CONTRACTURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNE SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY SKIN DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALE INFERTILITY WITH AZOOSPERMIA OR OLIGOZOOSPERMIA DUE TO SINGLE GENE MUTATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROTIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS VULGARIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STEVENS-JOHNSON SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma Of Esophagus	Esophageal Cancer	CTD_human_DG	23525077		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	23535033		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASDB_DG	23535033		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	31804889		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	30643265		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	34101054	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	25901943	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	31804889		★☆☆☆☆ Found in Text Mining only
AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 1	Autoimmune Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 2	Autoimmune Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	GWASCAT_DG	21383967, 30595370		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	GWASDB_DG	21383967		★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	GWASCAT_DG	21399635		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23591873	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	36718103	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24819662		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	31217360		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	31217360		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	25169573		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	GWASDB_DG	20190752, 22057235, 23143596		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	GWASCAT_DG	20190752, 25920553, 26546613		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic kidney disease stage 5	Kidney Disease	BEFREE	26858454		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	24253112		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30219846		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36310143	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	20835900		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	20835900		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	20835900		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	22592522		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	24433479, 25169573		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	24433479, 25169573, 31217360		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	19651817	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	17653210, 19183347, 20826100, 40215453, 40271977	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	19651817		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17653210, 19183347, 20826100, 22842811, 24433479, 28752301, 30708140		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	31217360		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	17653210, 19183347, 19651817, 20299368, 20826100, 31909452, 32634861, 40271977	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	15793258, 17418689, 17653210, 19183347, 19651817, 20299368, 20826100, 22721967, 22842811, 26858454, 27699784, 27849017, 31217360, 31798690		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	15793258, 19183347		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	CTD_human_DG	17942768		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	40215453	Associate	★☆☆☆☆ Found in Text Mining only
Drug-Induced Stevens Johnson Syndrome	Stevens-Johnson Syndrome	CTD_human_DG	25811541		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	26993296		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	23525077		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	28418867		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	28418867	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	17671188, 25870011		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	LHGDN	17671188		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypothyroidism	Hypothyroidism	GWASCAT_DG	30595370		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immune System Diseases	Immune System Diseases	GWASDB_DG	21383967		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	GWASCAT_DG	21383967		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	19183347, 19651817, 19838113, 20826100, 20835900, 22842811, 24433479, 27699784		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	19183347, 20826100, 40271977	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	19183347, 20826100	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	26858454		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	25360637	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31293644, 31324602		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	23591873	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	24819662		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28667327		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASCAT_DG	24076602		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mycoplasma-Induced Stevens-Johnson Syndrome	Stevens-Johnson Syndrome	CTD_human_DG	25811541		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	19407829		★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	GWASDB_DG	19629137		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31324602		★☆☆☆☆ Found in Text Mining only
Nodular glomerulosclerosis	Glomerulosclerosis	CTD_human_DG	17942768		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	24819662		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24819662	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	27849017		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	27662902		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	GWASDB_DG	21399635, 22961000		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary biliary cirrhosis	Biliary Cirrhosis	GWASCAT_DG	21399635, 22961000		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	GWASCAT_DG	23143594, 25574825		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	GWASDB_DG	23143594		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	23143596		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASCAT_DG	23143596, 26546613		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	25901943		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Carcinoma	BEFREE	28219480		★☆☆☆☆ Found in Text Mining only
Stevens-Johnson Syndrome	Stevens-Johnson Syndrome	CTD_human_DG	25811541		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stevens-Johnson Syndrome Toxic Epidermal Necrolysis Spectrum	Stevens-Johnson Syndrome	CTD_human_DG	25811541		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28418867, 29844130	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid cancer follicular	Follicular thyroid cancer	Pubtator	24099521	Associate	★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	CTD_human_DG	25811541		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30127952		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	22592522		★★☆☆☆ Found in Text Mining + Unknown/Other Associations