CDK1 (cyclin dependent kinase 1)

Gene

• Entrez ID: 983
• Gene name: Cyclin dependent kinase 1
• Gene symbol: CDK1
• Synonyms (NCBI Gene): CDC2, CDC28A, P34CDC2
• Chromosome: 10
• Chromosome location: 10q21.2
• Summary: The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is a catalytic subunit of the highly conserved protein kinase complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase trans

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT007328	hsa-miR-31-5p	Luciferase reporter assay	23233736
MIRT007328	hsa-miR-31-5p	Luciferase reporter assay	23233736
MIRT016140	hsa-miR-663a	Western blot;Other	20514450
MIRT016189	hsa-miR-590-3p	Sequencing	20371350
MIRT016442	hsa-miR-193b-3p	Microarray	20304954
MIRT030503	hsa-miR-24-3p	Microarray	19748357
MIRT030503	hsa-miR-24-3p	Reporter assay;Western blot;qRT-PCR;Microarray;Other	19748357
MIRT049057	hsa-miR-92a-3p	CLASH	23622248
MIRT438211	hsa-miR-302a-3p	qRT-PCR, Western blot	24333727
MIRT438211	hsa-miR-302a-3p	qRT-PCR, Western blot	24333727
MIRT438211	hsa-miR-302a-3p	qRT-PCR, Western blot	24333727
MIRT438211	hsa-miR-302a-3p	qRT-PCR, Western blot	24333727
MIRT262868	hsa-miR-6507-5p	HITS-CLIP	23313552
MIRT262866	hsa-miR-3910	HITS-CLIP	23313552
MIRT262867	hsa-miR-4714-5p	HITS-CLIP	23313552
MIRT691639	hsa-miR-514a-5p	HITS-CLIP	23313552
MIRT691638	hsa-miR-3664-5p	HITS-CLIP	23313552
MIRT262862	hsa-miR-935	HITS-CLIP	23313552
MIRT691637	hsa-miR-205-5p	HITS-CLIP	23313552
MIRT262858	hsa-miR-301a-5p	HITS-CLIP	23313552
MIRT262861	hsa-miR-301b-5p	HITS-CLIP	23313552
MIRT691636	hsa-miR-4750-3p	HITS-CLIP	23313552
MIRT262860	hsa-miR-556-3p	HITS-CLIP	23313552
MIRT262863	hsa-miR-4256	HITS-CLIP	23313552
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT507822	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT507821	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT507819	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT000268	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT507817	hsa-miR-4310	PAR-CLIP	20371350
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT507815	hsa-miR-4468	PAR-CLIP	20371350
MIRT562532	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT562531	hsa-miR-107	PAR-CLIP	20371350
MIRT507814	hsa-miR-2053	PAR-CLIP	20371350
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT507822	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT507821	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT507819	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT000268	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT507817	hsa-miR-4310	PAR-CLIP	20371350
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT507815	hsa-miR-4468	PAR-CLIP	20371350
MIRT562532	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT562531	hsa-miR-107	PAR-CLIP	20371350
MIRT507814	hsa-miR-2053	PAR-CLIP	20371350
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT507822	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT507821	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT507819	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT000268	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT507817	hsa-miR-4310	PAR-CLIP	20371350
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT558812	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT507815	hsa-miR-4468	PAR-CLIP	20371350
MIRT507814	hsa-miR-2053	PAR-CLIP	20371350
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT507822	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT507821	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT507819	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT000268	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT507817	hsa-miR-4310	PAR-CLIP	20371350
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT558812	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT507815	hsa-miR-4468	PAR-CLIP	20371350
MIRT562532	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT562531	hsa-miR-107	PAR-CLIP	20371350
MIRT507814	hsa-miR-2053	PAR-CLIP	20371350
MIRT330659	hsa-miR-5688	PAR-CLIP	21572407
MIRT330658	hsa-miR-495-3p	PAR-CLIP	21572407
MIRT558816	hsa-miR-3617-5p	PAR-CLIP	21572407
MIRT558815	hsa-miR-641	PAR-CLIP	21572407
MIRT330640	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT330635	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT262855	hsa-miR-5585-5p	PAR-CLIP	21572407
MIRT262854	hsa-miR-4670-3p	PAR-CLIP	21572407
MIRT558814	hsa-miR-3161	PAR-CLIP	21572407
MIRT558813	hsa-miR-599	PAR-CLIP	21572407
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT507822	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT507821	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT507819	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT000268	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT507817	hsa-miR-4310	PAR-CLIP	21572407
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	21572407
MIRT558812	hsa-miR-186-3p	PAR-CLIP	21572407
MIRT507815	hsa-miR-4468	PAR-CLIP	21572407
MIRT507814	hsa-miR-2053	PAR-CLIP	21572407
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT507822	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT507821	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT507819	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT000268	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT507817	hsa-miR-4310	PAR-CLIP	21572407
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	21572407
MIRT507815	hsa-miR-4468	PAR-CLIP	21572407
MIRT507814	hsa-miR-2053	PAR-CLIP	21572407
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT507822	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT507821	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT507819	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT000268	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT507817	hsa-miR-4310	PAR-CLIP	23446348
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	23446348
MIRT507815	hsa-miR-4468	PAR-CLIP	23446348
MIRT507814	hsa-miR-2053	PAR-CLIP	23446348
MIRT495648	hsa-miR-548aa	PAR-CLIP	22291592
MIRT495647	hsa-miR-548ap-3p	PAR-CLIP	22291592
MIRT495646	hsa-miR-548t-3p	PAR-CLIP	22291592
MIRT495645	hsa-miR-548as-3p	PAR-CLIP	22291592
MIRT495644	hsa-miR-548at-3p	PAR-CLIP	22291592
MIRT495643	hsa-miR-548ay-3p	PAR-CLIP	22291592
MIRT495642	hsa-miR-4747-3p	PAR-CLIP	22291592
MIRT495641	hsa-miR-1295b-3p	PAR-CLIP	22291592
MIRT495640	hsa-miR-488-5p	PAR-CLIP	22291592
MIRT732755	hsa-miR-125b-5p	Luciferase reporter assay, Western blotting	33859745
MIRT732872	hsa-miR-22-3p	Microarray	31848878
MIRT732873	hsa-miR-485-5p	Microarray	31848878
MIRT262868	hsa-miR-6507-5p	HITS-CLIP	23313552
MIRT262866	hsa-miR-3910	HITS-CLIP	23313552
MIRT262867	hsa-miR-4714-5p	HITS-CLIP	23313552
MIRT691639	hsa-miR-514a-5p	HITS-CLIP	23313552
MIRT691638	hsa-miR-3664-5p	HITS-CLIP	23313552
MIRT262862	hsa-miR-935	HITS-CLIP	23313552
MIRT691637	hsa-miR-205-5p	HITS-CLIP	23313552
MIRT262858	hsa-miR-301a-5p	HITS-CLIP	23313552
MIRT262861	hsa-miR-301b-5p	HITS-CLIP	23313552
MIRT691636	hsa-miR-4750-3p	HITS-CLIP	23313552
MIRT262860	hsa-miR-556-3p	HITS-CLIP	23313552
MIRT262863	hsa-miR-4256	HITS-CLIP	23313552
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT507822	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT507821	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT507819	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT000268	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT507817	hsa-miR-4310	PAR-CLIP	20371350
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT507815	hsa-miR-4468	PAR-CLIP	20371350
MIRT562532	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT562531	hsa-miR-107	PAR-CLIP	20371350
MIRT507814	hsa-miR-2053	PAR-CLIP	20371350
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT507822	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT507821	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT507819	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT000268	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT507817	hsa-miR-4310	PAR-CLIP	20371350
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT507815	hsa-miR-4468	PAR-CLIP	20371350
MIRT562532	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT562531	hsa-miR-107	PAR-CLIP	20371350
MIRT507814	hsa-miR-2053	PAR-CLIP	20371350
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT507822	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT507821	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT507819	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT000268	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT507817	hsa-miR-4310	PAR-CLIP	20371350
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT558812	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT507815	hsa-miR-4468	PAR-CLIP	20371350
MIRT507814	hsa-miR-2053	PAR-CLIP	20371350
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT507822	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT507821	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT507819	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT000268	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT507817	hsa-miR-4310	PAR-CLIP	20371350
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT558812	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT507815	hsa-miR-4468	PAR-CLIP	20371350
MIRT562532	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT562531	hsa-miR-107	PAR-CLIP	20371350
MIRT507814	hsa-miR-2053	PAR-CLIP	20371350
MIRT330659	hsa-miR-5688	PAR-CLIP	21572407
MIRT330658	hsa-miR-495-3p	PAR-CLIP	21572407
MIRT558816	hsa-miR-3617-5p	PAR-CLIP	21572407
MIRT558815	hsa-miR-641	PAR-CLIP	21572407
MIRT330640	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT330635	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT262855	hsa-miR-5585-5p	PAR-CLIP	21572407
MIRT262854	hsa-miR-4670-3p	PAR-CLIP	21572407
MIRT558814	hsa-miR-3161	PAR-CLIP	21572407
MIRT558813	hsa-miR-599	PAR-CLIP	21572407
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT507822	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT507821	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT507819	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT000268	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT507817	hsa-miR-4310	PAR-CLIP	21572407
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	21572407
MIRT558812	hsa-miR-186-3p	PAR-CLIP	21572407
MIRT507815	hsa-miR-4468	PAR-CLIP	21572407
MIRT507814	hsa-miR-2053	PAR-CLIP	21572407
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT507822	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT507821	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT507819	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT000268	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT507817	hsa-miR-4310	PAR-CLIP	21572407
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	21572407
MIRT507815	hsa-miR-4468	PAR-CLIP	21572407
MIRT507814	hsa-miR-2053	PAR-CLIP	21572407
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT507822	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT507821	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT507819	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT000268	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT507817	hsa-miR-4310	PAR-CLIP	23446348
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	23446348
MIRT507815	hsa-miR-4468	PAR-CLIP	23446348
MIRT507814	hsa-miR-2053	PAR-CLIP	23446348
MIRT495648	hsa-miR-548aa	PAR-CLIP	22291592
MIRT495647	hsa-miR-548ap-3p	PAR-CLIP	22291592
MIRT495646	hsa-miR-548t-3p	PAR-CLIP	22291592
MIRT495645	hsa-miR-548as-3p	PAR-CLIP	22291592
MIRT495644	hsa-miR-548at-3p	PAR-CLIP	22291592
MIRT495643	hsa-miR-548ay-3p	PAR-CLIP	22291592
MIRT495642	hsa-miR-4747-3p	PAR-CLIP	22291592
MIRT495641	hsa-miR-1295b-3p	PAR-CLIP	22291592
MIRT495640	hsa-miR-488-5p	PAR-CLIP	22291592
MIRT880273	hsa-miR-200b	CLIP-seq
MIRT880274	hsa-miR-200c	CLIP-seq
MIRT880275	hsa-miR-429	CLIP-seq
MIRT880276	hsa-miR-4495	CLIP-seq
MIRT880277	hsa-miR-4698	CLIP-seq
MIRT880278	hsa-miR-203	CLIP-seq
MIRT880279	hsa-miR-329	CLIP-seq
MIRT880280	hsa-miR-362-3p	CLIP-seq
MIRT880281	hsa-miR-3941	CLIP-seq
MIRT880282	hsa-miR-4786-5p	CLIP-seq
MIRT880283	hsa-miR-582-5p	CLIP-seq
MIRT880284	hsa-miR-603	CLIP-seq
MIRT880285	hsa-miR-769-5p	CLIP-seq
MIRT880286	hsa-miR-1200	CLIP-seq
MIRT880278	hsa-miR-203	CLIP-seq
MIRT880287	hsa-miR-3074-5p	CLIP-seq
MIRT880288	hsa-miR-330-3p	CLIP-seq
MIRT880289	hsa-miR-3545-3p	CLIP-seq
MIRT880290	hsa-miR-3688-3p	CLIP-seq
MIRT880291	hsa-miR-3913-3p	CLIP-seq
MIRT880292	hsa-miR-410	CLIP-seq
MIRT880293	hsa-miR-4261	CLIP-seq
MIRT880294	hsa-miR-4422	CLIP-seq
MIRT880295	hsa-miR-4795-3p	CLIP-seq
MIRT880296	hsa-miR-4803	CLIP-seq
MIRT880297	hsa-miR-489	CLIP-seq
MIRT880298	hsa-miR-495	CLIP-seq
MIRT880299	hsa-miR-548c-3p	CLIP-seq
MIRT880300	hsa-miR-656	CLIP-seq
MIRT880301	hsa-miR-888	CLIP-seq
MIRT1960803	hsa-miR-1179	CLIP-seq
MIRT1960804	hsa-miR-3685	CLIP-seq
MIRT1960805	hsa-miR-384	CLIP-seq
MIRT1960806	hsa-miR-4760-5p	CLIP-seq
MIRT1960807	hsa-miR-513a-3p	CLIP-seq
MIRT1960808	hsa-miR-628-3p	CLIP-seq
MIRT2446686	hsa-miR-3074-3p	CLIP-seq
MIRT2446687	hsa-miR-3121-3p	CLIP-seq
MIRT2446688	hsa-miR-3613-3p	CLIP-seq
MIRT880276	hsa-miR-4495	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ARID3A	Unknown	23659165
E2F1	Activation	14618416
E2F3	Unknown	16909110
ETS2	Unknown	7867724
IRF1	Repression	22200613
PTTG1	Activation	22475756
RB1	Unknown	8270002
SMAD7	Repression	15023526
TFDP1	Activation	14618416
TP53	Repression	12889596
TP53	Unknown	19067706
TP73	Unknown	19067706

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IDA	11687586
GO:0000082	Process	G1/S transition of mitotic cell cycle	NAS	1312467
GO:0000086	Process	G2/M transition of mitotic cell cycle	IBA
GO:0000086	Process	G2/M transition of mitotic cell cycle	IDA	19160488, 27030811
GO:0000086	Process	G2/M transition of mitotic cell cycle	IDA	2188730, 2344612, 30139873
GO:0000086	Process	G2/M transition of mitotic cell cycle	NAS	17495531
GO:0000086	Process	G2/M transition of mitotic cell cycle	NAS	1312467, 17495531
GO:0000086	Process	G2/M transition of mitotic cell cycle	TAS
GO:0000166	Function	Nucleotide binding	IEA
GO:0000226	Process	Microtubule cytoskeleton organization	IDA	34782749
GO:0000226	Process	Microtubule cytoskeleton organization	TAS	21655336
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IDA	1312467
GO:0000781	Component	Chromosome, telomeric region	HDA	19135898
GO:0001618	Function	Virus receptor activity	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0004672	Function	Protein kinase activity	IDA	22854038, 23574715
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	NAS	9001210
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	7588608, 11298763, 19879842, 21871177, 23509069, 25012651, 26829474, 27030108, 28479321, 31804178, 32491969, 34741373
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IBA
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IDA	2188730, 2344612, 10791892, 11069302, 18477460, 19202191, 23601106, 25753036, 30139873, 34734636, 37788673
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IEA
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IMP	24746669
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	7815540, 9001210, 9988268, 10373560, 11069302, 11574543, 11687586, 12612082, 15148369, 15657067, 17283331, 17349584, 17681274, 18337751, 18408765, 18477460, 19879842, 20395957, 21041660, 21871177, 23509069, 23543736, 23601106, 23602568, 23799914, 24218572, 24358021, 24658140, 252186
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	15767402, 16109376
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	15767402
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	TAS	19917720
GO:0005759	Component	Mitochondrial matrix	IDA	24746669
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005813	Component	Centrosome	IDA	17488717
GO:0005813	Component	Centrosome	IEA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005876	Component	Spindle microtubule	IDA	11069302
GO:0006260	Process	DNA replication	TAS	21655336
GO:0006281	Process	DNA repair	TAS	21655336
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006974	Process	DNA damage response	IDA	19202191
GO:0006998	Process	Nuclear envelope organization	IDA	2188730
GO:0007077	Process	Mitotic nuclear membrane disassembly	IDA	2188730
GO:0007095	Process	Mitotic G2 DNA damage checkpoint signaling	IBA
GO:0007095	Process	Mitotic G2 DNA damage checkpoint signaling	IEA
GO:0007098	Process	Centrosome cycle	TAS	19364923
GO:0007344	Process	Pronuclear fusion	TAS	21535261
GO:0008353	Function	RNA polymerase II CTD heptapeptide repeat kinase activity	IDA	12721286
GO:0008353	Function	RNA polymerase II CTD heptapeptide repeat kinase activity	IEA
GO:0009636	Process	Response to toxic substance	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010971	Process	Positive regulation of G2/M transition of mitotic cell cycle	IMP	24746669
GO:0014038	Process	Regulation of Schwann cell differentiation	TAS	17200138
GO:0014075	Process	Response to amine	IEA
GO:0014823	Process	Response to activity	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016301	Function	Kinase activity	IDA	28575661
GO:0016301	Function	Kinase activity	IEA
GO:0016477	Process	Cell migration	TAS	17200138
GO:0016579	Process	Protein deubiquitination	IDA	16378762
GO:0016579	Process	Protein deubiquitination	TAS
GO:0016740	Function	Transferase activity	IEA
GO:0018107	Process	Peptidyl-threonine phosphorylation	IMP	27238018
GO:0030261	Process	Chromosome condensation	IEA
GO:0030332	Function	Cyclin binding	IDA	7739547
GO:0030332	Function	Cyclin binding	IPI	1312467, 24746669
GO:0030496	Component	Midbody	IDA	11069302
GO:0030544	Function	Hsp70 protein binding	IEA
GO:0030855	Process	Epithelial cell differentiation	IEP	21492153
GO:0034501	Process	Protein localization to kinetochore	IDA	18195732
GO:0034501	Process	Protein localization to kinetochore	IMP	28479321
GO:0035173	Function	Histone kinase activity	IDA	21871177
GO:0035173	Function	Histone kinase activity	IEA
GO:0042307	Process	Positive regulation of protein import into nucleus	IEA
GO:0042542	Process	Response to hydrogen peroxide	IEA
GO:0042752	Process	Regulation of circadian rhythm	IMP	27238018
GO:0043066	Process	Negative regulation of apoptotic process	IDA	11069302
GO:0044772	Process	Mitotic cell cycle phase transition	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045740	Process	Positive regulation of DNA replication	IEA
GO:0045995	Process	Regulation of embryonic development	TAS	21535261
GO:0046105	Process	Thymidine biosynthetic process	IDA	14697231
GO:0046686	Process	Response to cadmium ion	IEA
GO:0046688	Process	Response to copper ion	IEA
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0046785	Process	Microtubule polymerization	IDA	10791892, 34782749
GO:0048144	Process	Fibroblast proliferation	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0048678	Process	Response to axon injury	IEA
GO:0051301	Process	Cell division	IEA
GO:0055015	Process	Ventricular cardiac muscle cell development	IEA
GO:0060045	Process	Positive regulation of cardiac muscle cell proliferation	IEA
GO:0061523	Process	Cilium disassembly	IDA	34782749
GO:0062033	Process	Positive regulation of mitotic sister chromatid segregation	IDA	26829474
GO:0065003	Process	Protein-containing complex assembly	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0070371	Process	ERK1 and ERK2 cascade	TAS
GO:0072686	Component	Mitotic spindle	IDA	17488717
GO:0090166	Process	Golgi disassembly	IEA
GO:0090166	Process	Golgi disassembly	ISS
GO:0097121	Component	Cyclin A1-CDK1 complex	NAS	19592082
GO:0097122	Component	Cyclin A2-CDK1 complex	IEA
GO:0097122	Component	Cyclin A2-CDK1 complex	NAS	1312467
GO:0097125	Component	Cyclin B1-CDK1 complex	IMP	24746669
GO:0097125	Component	Cyclin B1-CDK1 complex	IPI	17495531
GO:0097472	Function	Cyclin-dependent protein kinase activity	IDA	1312467
GO:0097472	Function	Cyclin-dependent protein kinase activity	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0110025	Process	DNA strand resection involved in replication fork processing	IDA	27814491, 27889449, 29670289, 30612738
GO:1900182	Process	Positive regulation of protein localization to nucleus	IMP	21871177
GO:1902423	Process	Regulation of attachment of mitotic spindle microtubules to kinetochore	IDA	28479321
GO:1902850	Process	Microtubule cytoskeleton organization involved in mitosis	IDA	10791892
GO:1904860	Process	DNA synthesis involved in mitotic DNA replication	IDA	14697231
GO:1905448	Process	Positive regulation of mitochondrial ATP synthesis coupled electron transport	IMP	24746669
GO:1990166	Process	Protein localization to site of double-strand break	IDA	27814491, 27889449
GO:1990506	Process	Mitotic DNA-templated DNA replication	IDA	28575661

Other IDs

• MIM: 116940
• HGNC: 1722
• e!Ensembl: ENSG00000170312

Protein

• UniProt ID: P06493
• Protein name: Cyclin-dependent kinase 1 (CDK1) (EC 2.7.11.22) (EC 2.7.11.23) (Cell division control protein 2 homolog) (Cell division protein kinase 1) (p34 protein kinase)
• Protein function: Plays a key role in the control of the eukaryotic cell cycle by modulating the centrosome cycle as well as mitotic onset; promotes G2-M transition via association with multiple interphase cyclins (PubMed:16407259, PubMed:16933150, PubMed:1745972
• PDB: 4Y72, 4YC3, 4YC6, 5HQ0, 5LQF, 6GU2, 6GU3, 6GU4, 6GU6, 6GU7, 6TWN, 7NJ0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	4 → 287	Protein kinase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: [Isoform 2]: Found in breast cancer tissues. {ECO:0000269|PubMed:9515786}.
• Sequence:

  MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
  PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
  SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
  YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
  FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM

• Sequence length: 297

Pathways

KEGG:

Cell cycle
Oocyte meiosis
p53 signaling pathway
Cellular senescence
Gap junction
Progesterone-mediated oocyte maturation
Human immunodeficiency virus 1 infection
Viral carcinogenesis

Reactome:

MAPK3 (ERK1) activation
Phosphorylation of proteins involved in the G2/M transition by Cyclin A:Cdc2 complexes
APC/C:Cdc20 mediated degradation of Cyclin B
Cdc20:Phospho-APC/C mediated degradation of Cyclin A
Regulation of APC/C activators between G1/S and early anaphase
Phosphorylation of the APC/C
Phosphorylation of Emi1
Condensation of Prophase Chromosomes
Resolution of Sister Chromatid Cohesion
Regulation of PLK1 Activity at G2/M Transition
Activation of NIMA Kinases NEK9, NEK6, NEK7
Initiation of Nuclear Envelope (NE) Reformation
Nuclear Pore Complex (NPC) Disassembly
Loss of Nlp from mitotic centrosomes
Recruitment of mitotic centrosome proteins and complexes
Loss of proteins required for interphase microtubule organization from the centrosome
Recruitment of NuMA to mitotic centrosomes
Depolymerisation of the Nuclear Lamina
Anchoring of the basal body to the plasma membrane
MAPK6/MAPK4 signaling
Ovarian tumor domain proteases
TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest
Regulation of TP53 Degradation
Mitotic Prophase
Cyclin A/B1/B2 associated events during G2/M transition
G2/M DNA replication checkpoint
Chk1/Chk2(Cds1) mediated inactivation of Cyclin B:Cdk1 complex
The role of GTSE1 in G2/M progression after G2 checkpoint
AURKA Activation by TPX2
Transcriptional regulation by RUNX2

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOMA, LARGE B-CELL, DIFFUSE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	7812949		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	24367507		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	15725809		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27835911, 29608985		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	28004354		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	9268294		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	30413320, 32147961, 32923148, 35123514, 37535572, 38053725	Associate	★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	19223503		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	11305412		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	31516579		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	11106571, 18076107, 21811019	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	17159347, 18076107		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	27268919		★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	17419986, 33168930	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30765611, 30898709		★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	39358545	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	31721906	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	23130941		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	31516579		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	32840301	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	11952644, 35782055	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	23335992, 27268919		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28740209		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	23330000, 25433945, 30384473		★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom syndrome	Pubtator	35119917	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21488187, 22209942, 23570421, 24386390, 24444383, 25218592, 25920913, 26691213, 27101368, 28739725, 28855742, 28927115, 30108112, 30272324, 31285549, 9515786, 9631067		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12049736, 19377877, 21821547, 21918689, 22094936, 22108518, 22580043, 24386390, 24444383, 25756514, 26691213, 28335434, 28739725, 28855742, 29196913, 29620220, 29693125, 30108112, 30272324, 30476929, 31315058, 31881805, 32546141, 32705365, 33285689, 33499770, 33867838, 34856073, 35348268, 35445733, 35456460, 35491766, 35949045, 36307489, 36604147, 36930083, 37978168, 38170155	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21488187, 34895070	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	16784539, 24386425, 26912061, 33178832, 35403252, 35782055, 36572570	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	26008974	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15317660, 19223178, 21488187, 29438113, 8809331		★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	31914060, 37861550	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	14645695	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	19259937	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15145941, 15298730, 21824427, 24083576, 25547487, 26002580, 26536659, 26755347, 26975930, 28381168, 28434945, 28640074, 29658607, 29728556, 29843214, 30272310, 30341252, 30473536, 30680535, 30702595, 30705088, 31043166, 31737652, 31790363, 31822116, 32275843, 32596342, 32627011, 32722976, 32746792, 32769939, 32863381, 33157984, 33390802, 33688500, 34257537, 34337056, 34556750, 34603487, 34746301, 34925377, 35078445, 35193513, 35236335, 35592706, 36002253, 36069218, 36120772, 36309506, 36317111, 36345011, 36347033, 36403263, 36479313, 36553600, 36572570, 37006050, 37215201, 37861550, 38025683, 38179744, 40179431, 40280030, 40332418	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34187556	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	40389832	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	31108958		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11705845, 21887332, 30002440, 30931929, 31378894		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	25910705, 32414422, 34794761	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	30765611, 35011251, 35403252	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25443276, 27144525, 27863441, 29559845, 30597305, 34870494, 35601741, 36152754, 37464398	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	25013792, 25849598, 31035650, 31642613, 36247089, 36714024, 37185598, 37442189	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19738611, 25819031, 25910705, 28598010		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	35485294	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	25786624, 29416014, 31303791		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	25786624, 29416014, 31303791		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	9399648		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	11305412		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	31545466, 36224755	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	31746435		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	26555773	Associate	★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	27384476, 33168930, 36516748	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30601084		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	28640074		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	26795696	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11705845, 15317660, 21348775, 30872078		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26506418, 27383761, 27546461, 28923355, 29069733, 29233910, 29663854, 30588014, 31190740, 31203132, 7779716		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12884029, 15073847		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15317660	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22108518, 23799036, 24009741, 24098334, 25511643, 26506418, 27383761, 27546461, 28177905, 28486948, 29663854, 31137244, 31375708, 32127012, 32737302, 33190424, 33744866, 34129943, 34959120, 35363355, 35774271, 36123948, 36303457, 36820595, 37428466, 37762548, 38134110, 7779716	Associate	★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	19223178		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27035563, 27863441, 29843367, 30597305		★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	Pubtator	34080795	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	26171692		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	33289509	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	30474315	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	31315286, 35628588	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	36303457	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	19223503, 23330000		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	CTD_human_DG	19223503		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	29039762		★☆☆☆☆ Found in Text Mining only
Embryonal Neoplasm	Embryonal Neoplasm	BEFREE	26029996		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	28682437, 30405846		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	28040131, 28682437, 33859719	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	18353325		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	32112646, 35303800	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	17359356		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	25910705		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	24829906, 25450480, 27585443, 34488675	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	32546690, 32662828, 34232175, 34517565, 34586751	Associate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	15082718, 9242535	Associate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	23929435, 9242535		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	23929435, 9242535		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	12648761		★☆☆☆☆ Found in Text Mining only
Ganglioglioma	Ganglioglioma	BEFREE	17359356		★☆☆☆☆ Found in Text Mining only
Ganglioglioma	Ganglioglioma	LHGDN	17359356		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	10623670	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	25707496		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	17324379, 23299390, 25433945, 27050366, 29901201, 31143512, 31416846, 31570001, 9858877		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	29901201, 32467990, 33707466, 38003585, 39528802, 40649712	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	17324379, 23299390, 25433945, 27050366, 29901201, 31143512, 31416846, 31570001, 9858877		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	16909107, 18230152, 30015885, 30272277, 31347720		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	18230152		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23133576, 30015885, 30405856, 33892537, 35774141, 39991761	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	30865617	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	17589519, 25060910		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	21488187, 9006317	Associate	★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	14674991		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	32112646, 36303457	Associate	★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	24694834		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	35738066	Stimulate	★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	22496227		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	29843367, 37047552	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	25120812	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	26912061		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	12417757, 15935816, 22797303, 23518499, 29435156		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	12417757	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	23518499	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	19385969, 23518499, 25844667, 35634845, 36509894	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	36813923	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	22797303, 23518499		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	15645429		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10094816, 12791511, 15082532, 15754328, 18393292, 19414386, 21310960, 21577206, 21824427, 21971960, 22241220, 23471882, 23619525, 25753876, 26002580, 26975930, 28434945, 28607595, 28640074, 29435009, 29503564, 29658607, 29728556, 30083256, 30104887, 30565332, 30697079, 30746803, 31790363		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	16036217, 18247328		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	28640074		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	37861550, 40332418	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	10094816, 12791511, 15754328, 19414386		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	32457348	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21887332, 28592245, 30002440, 31378894, 31854219, 32020821, 32646340, 33685293, 36714024	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	26663909		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	28740209, 37072474	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	26663909		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	26663909		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	28740209	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	26663909		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24386425	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25129248	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	12068134, 15015605	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	17589519, 31207099		★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Malformation of cortical development	LHGDN	17359356		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	25433945		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11948426, 16317763, 21488187, 22209942, 23570421, 24378347, 24386390, 24444383, 25218592, 25920913, 26691213, 27101368, 28739725, 28855742, 28927115, 30108112, 30272324, 31285549, 9515786, 9631067		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	30405846		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11705845, 21887332, 30002440, 30931929, 31378894		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	15645429		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19738611, 28598010		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23780887, 30358420, 30674344		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16024624, 17043241, 21111724, 21925791, 21969818, 28062857, 31429764		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23042672, 30200804		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	31709755		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11069302, 11894785, 16760651, 17178890, 17210692, 17589519, 21111724, 22391209, 22797303, 22970268, 23619525, 24362465, 25289887, 25920913, 26302802, 26569090, 26732650, 27358111, 28352193, 28402920, 28899430, 29074254, 29207595, 29559545, 29731906, 29901201, 29920767, 30045664, 30083256, 30107342, 30297536, 30647843, 31378894, 31668803, 7882308, 8318919, 8513148		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	25786624, 29416014, 31303791		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	11705845, 15317660, 30872078		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	BEFREE	9870146		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	11779217		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	21120602		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	11305412		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	29984917, 30678435	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10497214, 19305423, 19478684, 25831048, 30792348, 32612115, 36303457	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21691232, 23772146, 28352193, 30297536, 9973934		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35906389	Stimulate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	21157382, 37515398	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	22137483		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	19218339	Stimulate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	24327015, 33032291	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	19385969	Associate	★☆☆☆☆ Found in Text Mining only
Mosaic variegated aneuploidy syndrome	Mosaic variegated aneuploidy	Pubtator	16847100	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	27031247	Associate	★☆☆☆☆ Found in Text Mining only
Mullerian Aplasia and Hyperandrogenism	Mullerian Aplasia And Hyperandrogenism	BEFREE	31175162		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	21148814, 31048671, 31307247		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	26724804, 31048671, 32060401, 33197893	Associate	★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	31706019		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29752300		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	Pubtator	36226312	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	20607722, 9504608		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	27149165, 34064109, 34585634, 34664875, 35251377, 35509856, 35712071, 38050231	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	27149165	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	37861550	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10613309, 11305412, 15317660, 15645429, 15805280, 16458113, 16908595, 17434927, 18230152, 19239702, 19484144, 20926293, 21488187, 22094936, 22137483, 23023727, 24327015, 24386390, 25016158, 25733019, 25819031, 26081192, 26141949, 26691213, 26709398, 26824338, 26881434, 28425505, 28426773, 28855742, 29561622, 29731906, 29738841, 30045664, 30083256, 30365555, 30481564, 30588014, 30765611, 30898709, 30949170, 30955881, 31315058, 31709755, 31836849, 7882308, 8430082, 8809331, 9870146		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	31570001		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	26029996, 28253714		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	26029996	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	19124971, 19476463	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	12478465		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16982772, 24367507, 30195659		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30700550		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	27485598, 30038716		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	26555773	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30366983		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	25479727, 29731906, 31519809		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	29845265, 32665038, 34156352, 35056691, 38297292	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	28598010		★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	31311554		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	19738611		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25910705, 27039763, 29575713, 29758922, 32886452, 34072728, 34253236, 35843311	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34794761	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23780887, 30358420, 30674344		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	30765611, 30898709		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	17196098, 32537471, 39310930	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	37923686	Stimulate	★☆☆☆☆ Found in Text Mining only
Paranoid Disorders	Paranoia	Pubtator	23958962	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	30886221		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	12648761		★☆☆☆☆ Found in Text Mining only
Poikiloderma of Kindler	Poikiloderma Of Kindler	BEFREE	31260568		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	28244683		★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	31311554		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16024624, 17043241, 21111724, 21925791, 21969818, 28062857, 31429764		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12771130, 17043241		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12771130, 15961392, 17043241, 21867506, 21969818, 23321516, 24079846, 25519703, 26824323, 27029529, 28062857, 31300540, 33178832, 33932081, 33994848, 34082608, 34198380, 36834602, 37169162, 37682152, 39574470, 40022828	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	19738602		★☆☆☆☆ Found in Text Mining only
Psoriasiform eczema	Psoriasiform eczema	BEFREE	29138056		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	33416099	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	32586319	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	34704847	Associate	★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	10094816		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27035563, 27863441, 30597305		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	12902337, 17050806, 27647547, 29914080, 7511881, 7952399		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	33217867	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	31870357	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10094816		★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	16192727		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	39259097	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	36171070	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	33416099	Associate	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	31746355, 34397869	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	15662526		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	25013792		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23874958, 24386425, 25120812, 25129248, 26409447, 27644244, 30468474, 31210307, 35176168, 35806389, 37178584, 37401236	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26912061, 33982750	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	23874958		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of vulva	Carcinoma Of Vulva	BEFREE	25849598		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	14674991		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23042672, 30200804		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	17722244, 32759885, 33446695, 36167685	Associate	★☆☆☆☆ Found in Text Mining only
Subependymal Giant Cell Astrocytoma	Astrocytoma	BEFREE	12731003		★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	18245534		★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	25733019		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	26810418, 31591432	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	30213925, 31183379, 33025856, 33455115	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25016158, 27865619, 28991472, 29228549, 30845378		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35056723, 36238993, 36782089, 36813923, 36998242, 37667382, 38170155, 39819723	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	29532898, 33000254, 36181054, 37740761, 39456780	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33217824	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	31642613, 35008799	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	26701206, 27626412, 31337953, 34116656, 35409328, 9201712	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	35303800	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	33790887, 36890149	Associate	★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	30664180	Associate	★☆☆☆☆ Found in Text Mining only