Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9829
Gene name	DnaJ heat shock protein family (Hsp40) member C6
Gene symbol	DNAJC6
Synonyms (NCBI Gene)	DJC6PARK19
Chromosome	1
Chromosome location	1p31.3
Summary	DNAJC6 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N

Show/Hide all (6)

SNP ID	Visualize variation	Clinical significance	Consequence
rs398122404	A>G	Pathogenic	Splice acceptor variant
rs398122405	C>T	Pathogenic	Coding sequence variant, stop gained
rs864622011	C>T	Pathogenic, uncertain-significance	Coding sequence variant, stop gained
rs879255554	A>T	Pathogenic	Coding sequence variant, synonymous variant
rs879255630	A>G	Pathogenic	Missense variant, coding sequence variant
rs886039854	C>G,T	Pathogenic	Stop gained, coding sequence variant, missense variant

139

Show/Hide all (139)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030253	hsa-miR-26b-5p	Microarray	19088304
MIRT052398	hsa-let-7a-5p	CLASH	23622248
MIRT051833	hsa-let-7c-5p	CLASH	23622248
MIRT658964	hsa-miR-6721-5p	HITS-CLIP	23824327
MIRT658963	hsa-miR-486-3p	HITS-CLIP	23824327
MIRT658962	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT658961	hsa-miR-4425	HITS-CLIP	23824327
MIRT658960	hsa-miR-3147	HITS-CLIP	23824327
MIRT658959	hsa-miR-1227-5p	HITS-CLIP	23824327
MIRT658958	hsa-miR-4260	HITS-CLIP	23824327
MIRT658957	hsa-miR-4455	HITS-CLIP	23824327
MIRT658956	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT574878	hsa-miR-1227-5p	HITS-CLIP	27418678
MIRT574879	hsa-miR-3147	HITS-CLIP	27418678
MIRT574877	hsa-miR-4260	HITS-CLIP	27418678
MIRT574880	hsa-miR-4425	HITS-CLIP	27418678
MIRT574876	hsa-miR-4455	HITS-CLIP	27418678
MIRT574882	hsa-miR-486-3p	HITS-CLIP	27418678
MIRT574875	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT574881	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT574883	hsa-miR-6721-5p	HITS-CLIP	23824327
MIRT574882	hsa-miR-486-3p	HITS-CLIP	23824327
MIRT574881	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT574880	hsa-miR-4425	HITS-CLIP	23824327
MIRT574879	hsa-miR-3147	HITS-CLIP	23824327
MIRT574878	hsa-miR-1227-5p	HITS-CLIP	23824327
MIRT574877	hsa-miR-4260	HITS-CLIP	23824327
MIRT574876	hsa-miR-4455	HITS-CLIP	23824327
MIRT574875	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT941757	hsa-miR-1273f	CLIP-seq
MIRT941758	hsa-miR-194	CLIP-seq
MIRT941759	hsa-miR-2114	CLIP-seq
MIRT941760	hsa-miR-223	CLIP-seq
MIRT941761	hsa-miR-23a	CLIP-seq
MIRT941762	hsa-miR-23b	CLIP-seq
MIRT941763	hsa-miR-23c	CLIP-seq
MIRT941764	hsa-miR-3120-3p	CLIP-seq
MIRT941765	hsa-miR-3133	CLIP-seq
MIRT941766	hsa-miR-3146	CLIP-seq
MIRT941767	hsa-miR-3148	CLIP-seq
MIRT941768	hsa-miR-3613-5p	CLIP-seq
MIRT941769	hsa-miR-3688-3p	CLIP-seq
MIRT941770	hsa-miR-4310	CLIP-seq
MIRT941771	hsa-miR-4444	CLIP-seq
MIRT941772	hsa-miR-4511	CLIP-seq
MIRT941773	hsa-miR-4659a-3p	CLIP-seq
MIRT941774	hsa-miR-4659b-3p	CLIP-seq
MIRT941775	hsa-miR-4662a-5p	CLIP-seq
MIRT941776	hsa-miR-4697-3p	CLIP-seq
MIRT941777	hsa-miR-4699-3p	CLIP-seq
MIRT941778	hsa-miR-4803	CLIP-seq
MIRT941779	hsa-miR-494	CLIP-seq
MIRT941780	hsa-miR-548ag	CLIP-seq
MIRT941781	hsa-miR-548ai	CLIP-seq
MIRT941782	hsa-miR-548m	CLIP-seq
MIRT941783	hsa-miR-759	CLIP-seq
MIRT1548003	hsa-miR-1292	CLIP-seq
MIRT1548004	hsa-miR-4471	CLIP-seq
MIRT941775	hsa-miR-4662a-5p	CLIP-seq
MIRT1548005	hsa-miR-541	CLIP-seq
MIRT1548006	hsa-miR-584	CLIP-seq
MIRT1548007	hsa-miR-654-5p	CLIP-seq
MIRT1978778	hsa-miR-2116	CLIP-seq
MIRT941761	hsa-miR-23a	CLIP-seq
MIRT941762	hsa-miR-23b	CLIP-seq
MIRT941763	hsa-miR-23c	CLIP-seq
MIRT1978779	hsa-miR-3654	CLIP-seq
MIRT1978780	hsa-miR-375	CLIP-seq
MIRT1978781	hsa-miR-4273	CLIP-seq
MIRT1978782	hsa-miR-432	CLIP-seq
MIRT1978783	hsa-miR-4677-5p	CLIP-seq
MIRT1978784	hsa-miR-548g	CLIP-seq
MIRT1978785	hsa-miR-548p	CLIP-seq
MIRT1978786	hsa-miR-630	CLIP-seq
MIRT1978787	hsa-miR-876-3p	CLIP-seq
MIRT2213989	hsa-miR-3183	CLIP-seq
MIRT2213990	hsa-miR-3617	CLIP-seq
MIRT2213991	hsa-miR-4326	CLIP-seq
MIRT2213992	hsa-miR-4723-3p	CLIP-seq
MIRT2213993	hsa-miR-579	CLIP-seq
MIRT2213994	hsa-miR-641	CLIP-seq
MIRT2387022	hsa-miR-1184	CLIP-seq
MIRT2387023	hsa-miR-1205	CLIP-seq
MIRT2387024	hsa-miR-3158-5p	CLIP-seq
MIRT2387025	hsa-miR-4527	CLIP-seq
MIRT2448436	hsa-miR-1243	CLIP-seq
MIRT1978779	hsa-miR-3654	CLIP-seq
MIRT2448437	hsa-miR-4653-3p	CLIP-seq
MIRT2448438	hsa-miR-659	CLIP-seq
MIRT2387022	hsa-miR-1184	CLIP-seq
MIRT2387023	hsa-miR-1205	CLIP-seq
MIRT2518265	hsa-miR-1208	CLIP-seq
MIRT2518266	hsa-miR-125a-3p	CLIP-seq
MIRT2518267	hsa-miR-129-5p	CLIP-seq
MIRT2518268	hsa-miR-1301	CLIP-seq
MIRT2518269	hsa-miR-1305	CLIP-seq
MIRT2518270	hsa-miR-1323	CLIP-seq
MIRT2518271	hsa-miR-193a-5p	CLIP-seq
MIRT2518272	hsa-miR-198	CLIP-seq
MIRT2518273	hsa-miR-2052	CLIP-seq
MIRT2518274	hsa-miR-219-5p	CLIP-seq
MIRT2518275	hsa-miR-3064-3p	CLIP-seq
MIRT2518276	hsa-miR-3121-3p	CLIP-seq
MIRT2387024	hsa-miR-3158-5p	CLIP-seq
MIRT2518277	hsa-miR-338-5p	CLIP-seq
MIRT2518278	hsa-miR-345	CLIP-seq
MIRT2518279	hsa-miR-3613-3p	CLIP-seq
MIRT2518280	hsa-miR-3647-3p	CLIP-seq
MIRT2518281	hsa-miR-3662	CLIP-seq
MIRT2518282	hsa-miR-3665	CLIP-seq
MIRT2518283	hsa-miR-374a	CLIP-seq
MIRT2518284	hsa-miR-374b	CLIP-seq
MIRT2518285	hsa-miR-3944-5p	CLIP-seq
MIRT2518286	hsa-miR-4445	CLIP-seq
MIRT2518287	hsa-miR-4461	CLIP-seq
MIRT2518288	hsa-miR-4477a	CLIP-seq
MIRT2518289	hsa-miR-448	CLIP-seq
MIRT2387025	hsa-miR-4527	CLIP-seq
MIRT2518290	hsa-miR-4641	CLIP-seq
MIRT2518291	hsa-miR-4660	CLIP-seq
MIRT2518292	hsa-miR-4679	CLIP-seq
MIRT2518293	hsa-miR-4699-5p	CLIP-seq
MIRT2518294	hsa-miR-4709-3p	CLIP-seq
MIRT2518295	hsa-miR-4782-3p	CLIP-seq
MIRT2518296	hsa-miR-5047	CLIP-seq
MIRT2518297	hsa-miR-508-3p	CLIP-seq
MIRT2518298	hsa-miR-5096	CLIP-seq
MIRT2518299	hsa-miR-511	CLIP-seq
MIRT2518300	hsa-miR-513b	CLIP-seq
MIRT2518301	hsa-miR-518a-5p	CLIP-seq
MIRT2518302	hsa-miR-527	CLIP-seq
MIRT2518303	hsa-miR-548o	CLIP-seq
MIRT2518304	hsa-miR-577	CLIP-seq
MIRT2518305	hsa-miR-603	CLIP-seq
MIRT2518306	hsa-miR-607	CLIP-seq
MIRT2518307	hsa-miR-615-5p	CLIP-seq
MIRT2518308	hsa-miR-656	CLIP-seq
MIRT2518309	hsa-miR-657	CLIP-seq
MIRT2387025	hsa-miR-4527	CLIP-seq

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	IEA
GO:0005515	Function	Protein binding	IPI	29735704
GO:0005737	Component	Cytoplasm	IBA
GO:0005829	Component	Cytosol	TAS
GO:0014069	Component	Postsynaptic density	IBA
GO:0014069	Component	Postsynaptic density	IEA
GO:0016191	Process	Synaptic vesicle uncoating	IBA
GO:0016191	Process	Synaptic vesicle uncoating	IEA
GO:0016191	Process	Synaptic vesicle uncoating	ISS	20160091
GO:0016787	Function	Hydrolase activity	IEA
GO:0017124	Function	SH3 domain binding	IEA
GO:0030136	Component	Clathrin-coated vesicle	IEA
GO:0030136	Component	Clathrin-coated vesicle	ISS
GO:0030276	Function	Clathrin binding	IBA
GO:0030276	Function	Clathrin binding	ISS
GO:0031072	Function	Heat shock protein binding	ISS
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031982	Component	Vesicle	IBA
GO:0032050	Function	Clathrin heavy chain binding	ISS
GO:0036465	Process	Synaptic vesicle recycling	IEA
GO:0036465	Process	Synaptic vesicle recycling	ISS
GO:0043231	Component	Intracellular membrane-bounded organelle	IBA
GO:0045202	Component	Synapse	IEA
GO:0046907	Process	Intracellular transport	IMP	18489706
GO:0072318	Process	Clathrin coat disassembly	IEA
GO:0072318	Process	Clathrin coat disassembly	ISS
GO:0072583	Process	Clathrin-dependent endocytosis	IBA
GO:0072583	Process	Clathrin-dependent endocytosis	IEA
GO:0072583	Process	Clathrin-dependent endocytosis	IMP	18489706
GO:0072583	Process	Clathrin-dependent endocytosis	ISS
GO:0098894	Component	Extrinsic component of presynaptic endocytic zone membrane	IEA
GO:1905443	Process	Regulation of clathrin coat assembly	IEA
GO:1905443	Process	Regulation of clathrin coat assembly	IMP	18489706
GO:2000369	Process	Regulation of clathrin-dependent endocytosis	IEA

MIM	HGNC	e!Ensembl
608375	15469	ENSG00000116675

O75061

Protein name

Auxilin (EC 3.1.3.-) (DnaJ homolog subfamily C member 6)

Protein function

May act as a protein phosphatase and/or a lipid phosphatase. Co-chaperone that recruits HSPA8/HSC70 to clathrin-coated vesicles (CCVs) and promotes the ATP-dependent dissociation of clathrin from CCVs and participates in clathrin-mediated endocy

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10409	PTEN_C2	226 → 365	C2 domain of PTEN tumour-suppressor protein	Domain
PF00226	DnaJ	852 → 913	DnaJ domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in various brain regions, including cerebellum, corpus callosum, cortex, striatum, brainstem, pons, putamen, spinal cord and substantia nigra. Very low expression in non-neural tissues such as leukocytes, liver, adipose tissu

Sequence

MKDSENKGASSPDMEPSYGGGLFDMVKGGAGRLFSNLKDNLKDTLKDTSSRVIQSVTSYT
KGDLDFTYVTSRIIVMSFPLDNVDIGFRNQVDDIRSFLDSRHLDHYTVYNLSPKSYRTAK
FHSRVSECSWPIRQAPSLHNLFAVCRNMYNWLLQNPKNVCVVHCLDGRAASSILVGAMFI
FCNLYSTPGPAIRLLYAKRPGIGLSPSHRRYLGYMCDLLADKPYRPHFKPLTIKSITVSP
IPFFNKQRNGCRPYCDVLIGETKIYSTCTDFERMKEYRVQDGKIFIPLNITVQGDVVVSM
YHLRSTIGSRLQAKVTNTQIFQLQFHTGFIPLDTTVLKFTKPELDACDVPEKYPQLFQVT
LDVELQPHDKVIDLTPPWEHYCTKDVNPSILFSSHQEHQDTLALGGQAPIDIPPDNPRHY
GQSGFFASLCWQDQKSEKSFCEEDHAALVNQESEQSDDELLTLSSPHGNANGDKPHGVKK
PSKKQQEPAAPPPPEDVDLLGLEGSAMSNSFSPPAAPPTNSELLSDLFGGGGAAGPTQAG
QSGVEDVFHPSGPASTQSTPRRSATSTSASPTLRVGEGATFDPFGAPSKPSGQDLLGSFL
NTSSASSDPFLQPTRSPSPTVHASSTPAVNIQPDVSGGWDWHAKPGGFGMGSKSAATSPT
GSSHGTPTHQSKPQTLDPFADLGTLGSSSFASKPTTPTGLGGGFPPLSSPQKASPQPMGG
GWQQGGAYNWQQPQPKPQPSMPHSSPQNRPNYNVSFSAMPGGQNERGKGSSNLEGKQKAA
DFEDLLSGQGFNAHKDKKGPRTIAEMRKEEMAKEMDPEKLKILEWIEGKERNIRALLSTM
HTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDA
WSEFENQGQKPLY

Sequence length

913

Interactions

View interactions

	KEGG		Reactome
	Endocytosis		Lysosome Vesicle Biogenesis Golgi Associated Vesicle Biogenesis Clathrin-mediated endocytosis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Juvenile onset Parkinson disease 19A	Pathogenic; Likely pathogenic	rs2101635447, rs1645848679, rs1219237924, rs2525233935, rs864622011, rs879255630, rs886039854, rs2525354474, rs398122404, rs398122405, rs1645867120	RCV001993208 RCV001915434 RCV002221918 RCV003028242 RCV000801660 View all (6 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Juvenile-onset diabetes mellitus-central and peripheral neurodegeneration syndrome	Pathogenic	rs398122404	RCV001030777	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Parkinson disease 19B, early-onset	Pathogenic	rs879255630	RCV000239521	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Prostate cancer	Pathogenic	rs864622011	RCV000204926	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (22)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATYPICAL JUVENILE PARKINSONISM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THROMBOCYTOPENIC PURPURA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	not provided	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DNAJC6-related disorder	Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign; Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMIPARKINSONISM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC OSTEONECROSIS OF THE FEMORAL HEAD	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC PARKINSONISM OR PARKINSONS DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE-ONSET DIABETES MELLITUS, CENTRAL AND PERIPHERAL NEURODEGENERATION SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic adenocarcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE 19A, JUVENILE-ONSET	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
YOUNG ONSET PARKINSON DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
YOUNG-ONSET PARKINSON DISEASE	—	CTD, Orphanet CTD, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (65)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Abnormal male sexual function	Abnormal Male Sexual Function	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Akinesia	Akinesia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	34948429	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anarthria speech disorder	Anarthria Speech Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Atypical juvenile parkinsonism	Parkinsonian disease	ORPHANET_DG	22563501, 23211418		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atypical juvenile parkinsonism	Parkinsonian disease	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain atrophy	Brain atrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34312475	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	30373961	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	31889077	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	28676412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia of frontal lobe type	Dementia Of Frontal Lobe	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysarthria	Dysarthria	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystonia	Dystonia	Pubtator	38242634	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	22647716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Female sexual dysfunction	Female sexual dysfunction	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroparesis	Gastroparesis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	10920277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	32472658	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	24155895	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	22647716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	22647716	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	34948429	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25446072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Male sexual dysfunction	Male sexual dysfunction	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	22647716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	GWASDB_DG	21211798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10970827, 11219390, 11751500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	32472658, 33597231	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	26965686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental disorder	Pubtator	33597231	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	22647716, 23211418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	22647716, 39771044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	37555827	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Panic Attacks	Panic Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	24126164, 28147270, 29735704, 30373961, 30509690		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	29735704, 30373961, 33597231, 34148545, 34948429, 38219303	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE 19A, JUVENILE-ONSET	Parkinson disease	UNIPROT_DG	22563501, 23211418, 26528954, 26703368		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE 19A, JUVENILE-ONSET	Parkinson disease	GENOMICS_ENGLAND_DG	22563501, 23211418, 26703368		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE 19A, JUVENILE-ONSET	Parkinson disease	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE 19A, JUVENILE-ONSET	Parkinson disease	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE 19B, EARLY-ONSET	Parkinson disease	GENOMICS_ENGLAND_DG	22563501, 23211418, 26703368		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
PARKINSON DISEASE 19B, EARLY-ONSET	Parkinson disease	CLINVAR_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
PARKINSON DISEASE 2, AUTOSOMAL RECESSIVE JUVENILE	Parkinson Disease	BEFREE	26528954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease Secondary	Secondary parkinson disease	Pubtator	32472658, 38242634	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson disease	Pubtator	22563501, 32472658	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	23211418, 23804577, 31120186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonism, Juvenile	Parkinsonian disease	BEFREE	22563501, 23211418, 24262182, 25446072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36922933	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Restless Legs Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	19165527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Social Communication Disorder	Social Communication Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Young onset Parkinson disease	Parkinson disease	BEFREE	26528954, 27687717, 30373961		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Young-onset Parkinson disease	Parkinson disease	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

DNAJC6 (DnaJ heat shock protein family (Hsp40) member C6)