Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9824
Gene name	Rho GTPase activating protein 11A
Gene symbol	ARHGAP11A
Synonyms (NCBI Gene)	GAP (1-12)
Chromosome	15
Chromosome location	15q13.3
Summary	This gene encodes a member of the Rho GTPase activating protein family. In response to DNA damage, the encoded protein interacts with the p53 tumor suppressor protein and stimulates its tetramerization, which results in cell-cycle arrest and apoptosis. A

293

Show/Hide all (293)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016546	hsa-miR-193b-3p	Microarray	20304954
MIRT019996	hsa-miR-375	Microarray	20215506
MIRT024265	hsa-miR-215-5p	Microarray	19074876
MIRT026824	hsa-miR-192-5p	Microarray	19074876
MIRT031280	hsa-miR-19b-3p	Sequencing	20371350
MIRT524891	hsa-miR-5197-5p	PAR-CLIP	21572407
MIRT524889	hsa-miR-6808-5p	PAR-CLIP	21572407
MIRT524890	hsa-miR-6893-5p	PAR-CLIP	21572407
MIRT524888	hsa-miR-940	PAR-CLIP	21572407
MIRT524887	hsa-miR-3929	PAR-CLIP	21572407
MIRT524886	hsa-miR-4419b	PAR-CLIP	21572407
MIRT524885	hsa-miR-4478	PAR-CLIP	21572407
MIRT524883	hsa-miR-4649-3p	PAR-CLIP	21572407
MIRT524882	hsa-miR-1827	PAR-CLIP	21572407
MIRT524881	hsa-miR-485-5p	PAR-CLIP	21572407
MIRT524880	hsa-miR-6884-5p	PAR-CLIP	21572407
MIRT524879	hsa-miR-873-5p	PAR-CLIP	21572407
MIRT524878	hsa-miR-7160-5p	PAR-CLIP	21572407
MIRT524877	hsa-miR-3622b-5p	PAR-CLIP	21572407
MIRT524876	hsa-miR-665	PAR-CLIP	21572407
MIRT541984	hsa-miR-548m	PAR-CLIP	21572407
MIRT541983	hsa-miR-548ag	PAR-CLIP	21572407
MIRT541982	hsa-miR-548ai	PAR-CLIP	21572407
MIRT541981	hsa-miR-548ba	PAR-CLIP	21572407
MIRT541980	hsa-miR-570-5p	PAR-CLIP	21572407
MIRT541978	hsa-miR-4797-5p	PAR-CLIP	21572407
MIRT541979	hsa-miR-508-5p	PAR-CLIP	21572407
MIRT541976	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT541977	hsa-miR-3690	PAR-CLIP	21572407
MIRT541975	hsa-miR-766-3p	PAR-CLIP	21572407
MIRT541973	hsa-miR-6730-5p	PAR-CLIP	21572407
MIRT541974	hsa-miR-5702	PAR-CLIP	21572407
MIRT541972	hsa-miR-1254	PAR-CLIP	21572407
MIRT541971	hsa-miR-3116	PAR-CLIP	21572407
MIRT541970	hsa-miR-6512-3p	PAR-CLIP	21572407
MIRT541969	hsa-miR-6720-5p	PAR-CLIP	21572407
MIRT524891	hsa-miR-5197-5p	PAR-CLIP	23446348
MIRT524889	hsa-miR-6808-5p	PAR-CLIP	23446348
MIRT524890	hsa-miR-6893-5p	PAR-CLIP	23446348
MIRT524888	hsa-miR-940	PAR-CLIP	23446348
MIRT524887	hsa-miR-3929	PAR-CLIP	23446348
MIRT524886	hsa-miR-4419b	PAR-CLIP	23446348
MIRT524885	hsa-miR-4478	PAR-CLIP	23446348
MIRT524884	hsa-miR-6840-3p	PAR-CLIP	23446348
MIRT524883	hsa-miR-4649-3p	PAR-CLIP	23446348
MIRT524882	hsa-miR-1827	PAR-CLIP	23446348
MIRT524881	hsa-miR-485-5p	PAR-CLIP	23446348
MIRT524880	hsa-miR-6884-5p	PAR-CLIP	23446348
MIRT524879	hsa-miR-873-5p	PAR-CLIP	23446348
MIRT524878	hsa-miR-7160-5p	PAR-CLIP	23446348
MIRT524877	hsa-miR-3622b-5p	PAR-CLIP	23446348
MIRT524876	hsa-miR-665	PAR-CLIP	23446348
MIRT441205	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT441205	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT524891	hsa-miR-5197-5p	PAR-CLIP	21572407
MIRT524889	hsa-miR-6808-5p	PAR-CLIP	21572407
MIRT524890	hsa-miR-6893-5p	PAR-CLIP	21572407
MIRT524888	hsa-miR-940	PAR-CLIP	21572407
MIRT524887	hsa-miR-3929	PAR-CLIP	21572407
MIRT524886	hsa-miR-4419b	PAR-CLIP	21572407
MIRT524885	hsa-miR-4478	PAR-CLIP	21572407
MIRT524883	hsa-miR-4649-3p	PAR-CLIP	21572407
MIRT524882	hsa-miR-1827	PAR-CLIP	21572407
MIRT524881	hsa-miR-485-5p	PAR-CLIP	21572407
MIRT524880	hsa-miR-6884-5p	PAR-CLIP	21572407
MIRT524879	hsa-miR-873-5p	PAR-CLIP	21572407
MIRT524878	hsa-miR-7160-5p	PAR-CLIP	21572407
MIRT524877	hsa-miR-3622b-5p	PAR-CLIP	21572407
MIRT524876	hsa-miR-665	PAR-CLIP	21572407
MIRT541984	hsa-miR-548m	PAR-CLIP	21572407
MIRT541983	hsa-miR-548ag	PAR-CLIP	21572407
MIRT541982	hsa-miR-548ai	PAR-CLIP	21572407
MIRT541981	hsa-miR-548ba	PAR-CLIP	21572407
MIRT541980	hsa-miR-570-5p	PAR-CLIP	21572407
MIRT541978	hsa-miR-4797-5p	PAR-CLIP	21572407
MIRT541979	hsa-miR-508-5p	PAR-CLIP	21572407
MIRT541976	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT541977	hsa-miR-3690	PAR-CLIP	21572407
MIRT541975	hsa-miR-766-3p	PAR-CLIP	21572407
MIRT541973	hsa-miR-6730-5p	PAR-CLIP	21572407
MIRT541974	hsa-miR-5702	PAR-CLIP	21572407
MIRT541972	hsa-miR-1254	PAR-CLIP	21572407
MIRT541971	hsa-miR-3116	PAR-CLIP	21572407
MIRT541970	hsa-miR-6512-3p	PAR-CLIP	21572407
MIRT541969	hsa-miR-6720-5p	PAR-CLIP	21572407
MIRT524891	hsa-miR-5197-5p	PAR-CLIP	23446348
MIRT524889	hsa-miR-6808-5p	PAR-CLIP	23446348
MIRT524890	hsa-miR-6893-5p	PAR-CLIP	23446348
MIRT524888	hsa-miR-940	PAR-CLIP	23446348
MIRT524887	hsa-miR-3929	PAR-CLIP	23446348
MIRT524886	hsa-miR-4419b	PAR-CLIP	23446348
MIRT524885	hsa-miR-4478	PAR-CLIP	23446348
MIRT524884	hsa-miR-6840-3p	PAR-CLIP	23446348
MIRT524883	hsa-miR-4649-3p	PAR-CLIP	23446348
MIRT524882	hsa-miR-1827	PAR-CLIP	23446348
MIRT524881	hsa-miR-485-5p	PAR-CLIP	23446348
MIRT524880	hsa-miR-6884-5p	PAR-CLIP	23446348
MIRT524879	hsa-miR-873-5p	PAR-CLIP	23446348
MIRT524878	hsa-miR-7160-5p	PAR-CLIP	23446348
MIRT524877	hsa-miR-3622b-5p	PAR-CLIP	23446348
MIRT524876	hsa-miR-665	PAR-CLIP	23446348
MIRT756021	hsa-miR-211-5p	Luciferase reporter assayWestern blottingqRT-PCR	35495761
MIRT793551	hsa-miR-1200	CLIP-seq
MIRT793552	hsa-miR-1283	CLIP-seq
MIRT793553	hsa-miR-1305	CLIP-seq
MIRT793554	hsa-miR-137	CLIP-seq
MIRT793555	hsa-miR-1908	CLIP-seq
MIRT793556	hsa-miR-196a	CLIP-seq
MIRT793557	hsa-miR-196b	CLIP-seq
MIRT793558	hsa-miR-19a	CLIP-seq
MIRT793559	hsa-miR-19b	CLIP-seq
MIRT793560	hsa-miR-204	CLIP-seq
MIRT793561	hsa-miR-211	CLIP-seq
MIRT793562	hsa-miR-2113	CLIP-seq
MIRT793563	hsa-miR-2114	CLIP-seq
MIRT793564	hsa-miR-2278	CLIP-seq
MIRT793565	hsa-miR-3117-3p	CLIP-seq
MIRT793566	hsa-miR-3134	CLIP-seq
MIRT793567	hsa-miR-3169	CLIP-seq
MIRT793568	hsa-miR-3667-3p	CLIP-seq
MIRT793569	hsa-miR-3676	CLIP-seq
MIRT793570	hsa-miR-3692	CLIP-seq
MIRT793571	hsa-miR-4252	CLIP-seq
MIRT793572	hsa-miR-4275	CLIP-seq
MIRT793573	hsa-miR-4324	CLIP-seq
MIRT793574	hsa-miR-4327	CLIP-seq
MIRT793575	hsa-miR-433	CLIP-seq
MIRT793576	hsa-miR-4452	CLIP-seq
MIRT793577	hsa-miR-4474-5p	CLIP-seq
MIRT793578	hsa-miR-4528	CLIP-seq
MIRT793579	hsa-miR-4534	CLIP-seq
MIRT793580	hsa-miR-4633-3p	CLIP-seq
MIRT793581	hsa-miR-4680-3p	CLIP-seq
MIRT793582	hsa-miR-4712-3p	CLIP-seq
MIRT793583	hsa-miR-4720-3p	CLIP-seq
MIRT793584	hsa-miR-4724-5p	CLIP-seq
MIRT793585	hsa-miR-4727-5p	CLIP-seq
MIRT793586	hsa-miR-4755-5p	CLIP-seq
MIRT793587	hsa-miR-4759	CLIP-seq
MIRT793588	hsa-miR-4762-5p	CLIP-seq
MIRT793589	hsa-miR-4773	CLIP-seq
MIRT793590	hsa-miR-4775	CLIP-seq
MIRT793591	hsa-miR-4778-5p	CLIP-seq
MIRT793592	hsa-miR-4780	CLIP-seq
MIRT793593	hsa-miR-4793-3p	CLIP-seq
MIRT793594	hsa-miR-4793-5p	CLIP-seq
MIRT793595	hsa-miR-4795-5p	CLIP-seq
MIRT793596	hsa-miR-4804-3p	CLIP-seq
MIRT793597	hsa-miR-494	CLIP-seq
MIRT793598	hsa-miR-498	CLIP-seq
MIRT793599	hsa-miR-499-3p	CLIP-seq
MIRT793600	hsa-miR-499a-3p	CLIP-seq
MIRT793601	hsa-miR-544b	CLIP-seq
MIRT793602	hsa-miR-548n	CLIP-seq
MIRT793603	hsa-miR-548t	CLIP-seq
MIRT793604	hsa-miR-550b	CLIP-seq
MIRT793605	hsa-miR-582-5p	CLIP-seq
MIRT793606	hsa-miR-590-3p	CLIP-seq
MIRT793607	hsa-miR-610	CLIP-seq
MIRT793608	hsa-miR-623	CLIP-seq
MIRT793609	hsa-miR-663	CLIP-seq
MIRT793610	hsa-miR-766	CLIP-seq
MIRT793611	hsa-miR-944	CLIP-seq
MIRT793612	hsa-miR-2052	CLIP-seq
MIRT793613	hsa-miR-4307	CLIP-seq
MIRT793614	hsa-miR-4659a-5p	CLIP-seq
MIRT793615	hsa-miR-4659b-5p	CLIP-seq
MIRT793616	hsa-miR-4776-3p	CLIP-seq
MIRT793578	hsa-miR-4528	CLIP-seq
MIRT793551	hsa-miR-1200	CLIP-seq
MIRT1934162	hsa-miR-1268	CLIP-seq
MIRT1934163	hsa-miR-1268b	CLIP-seq
MIRT793552	hsa-miR-1283	CLIP-seq
MIRT1934164	hsa-miR-24	CLIP-seq
MIRT1934165	hsa-miR-3122	CLIP-seq
MIRT1934166	hsa-miR-3143	CLIP-seq
MIRT1934167	hsa-miR-3689a-3p	CLIP-seq
MIRT1934168	hsa-miR-3689c	CLIP-seq
MIRT1934169	hsa-miR-3913-5p	CLIP-seq
MIRT1934170	hsa-miR-4284	CLIP-seq
MIRT793573	hsa-miR-4324	CLIP-seq
MIRT1934171	hsa-miR-4728-5p	CLIP-seq
MIRT793594	hsa-miR-4793-5p	CLIP-seq
MIRT793596	hsa-miR-4804-3p	CLIP-seq
MIRT1934172	hsa-miR-543	CLIP-seq
MIRT793601	hsa-miR-544b	CLIP-seq
MIRT793607	hsa-miR-610	CLIP-seq
MIRT1934162	hsa-miR-1268	CLIP-seq
MIRT1934163	hsa-miR-1268b	CLIP-seq
MIRT793552	hsa-miR-1283	CLIP-seq
MIRT793558	hsa-miR-19a	CLIP-seq
MIRT793559	hsa-miR-19b	CLIP-seq
MIRT793562	hsa-miR-2113	CLIP-seq
MIRT793563	hsa-miR-2114	CLIP-seq
MIRT2174031	hsa-miR-2276	CLIP-seq
MIRT1934164	hsa-miR-24	CLIP-seq
MIRT1934165	hsa-miR-3122	CLIP-seq
MIRT2174032	hsa-miR-3197	CLIP-seq
MIRT2174033	hsa-miR-323-3p	CLIP-seq
MIRT2174034	hsa-miR-3646	CLIP-seq
MIRT793569	hsa-miR-3676	CLIP-seq
MIRT2174035	hsa-miR-3680	CLIP-seq
MIRT1934167	hsa-miR-3689a-3p	CLIP-seq
MIRT1934168	hsa-miR-3689c	CLIP-seq
MIRT2174036	hsa-miR-3691-3p	CLIP-seq
MIRT793570	hsa-miR-3692	CLIP-seq
MIRT1934169	hsa-miR-3913-5p	CLIP-seq
MIRT793571	hsa-miR-4252	CLIP-seq
MIRT793572	hsa-miR-4275	CLIP-seq
MIRT1934170	hsa-miR-4284	CLIP-seq
MIRT2174037	hsa-miR-4464	CLIP-seq
MIRT2174038	hsa-miR-4699-3p	CLIP-seq
MIRT1934171	hsa-miR-4728-5p	CLIP-seq
MIRT2174039	hsa-miR-4748	CLIP-seq
MIRT2174040	hsa-miR-4767	CLIP-seq
MIRT793589	hsa-miR-4773	CLIP-seq
MIRT793593	hsa-miR-4793-3p	CLIP-seq
MIRT793594	hsa-miR-4793-5p	CLIP-seq
MIRT793595	hsa-miR-4795-5p	CLIP-seq
MIRT2174041	hsa-miR-4798-3p	CLIP-seq
MIRT793599	hsa-miR-499-3p	CLIP-seq
MIRT793600	hsa-miR-499a-3p	CLIP-seq
MIRT793602	hsa-miR-548n	CLIP-seq
MIRT793603	hsa-miR-548t	CLIP-seq
MIRT793610	hsa-miR-766	CLIP-seq
MIRT793611	hsa-miR-944	CLIP-seq
MIRT793553	hsa-miR-1305	CLIP-seq
MIRT2174034	hsa-miR-3646	CLIP-seq
MIRT1934162	hsa-miR-1268	CLIP-seq
MIRT1934163	hsa-miR-1268b	CLIP-seq
MIRT2443901	hsa-miR-1537	CLIP-seq
MIRT793555	hsa-miR-1908	CLIP-seq
MIRT1934165	hsa-miR-3122	CLIP-seq
MIRT2174032	hsa-miR-3197	CLIP-seq
MIRT2443902	hsa-miR-3613-3p	CLIP-seq
MIRT1934167	hsa-miR-3689a-3p	CLIP-seq
MIRT1934168	hsa-miR-3689c	CLIP-seq
MIRT1934169	hsa-miR-3913-5p	CLIP-seq
MIRT793571	hsa-miR-4252	CLIP-seq
MIRT2443903	hsa-miR-4486	CLIP-seq
MIRT2443904	hsa-miR-4684-5p	CLIP-seq
MIRT1934171	hsa-miR-4728-5p	CLIP-seq
MIRT2174040	hsa-miR-4767	CLIP-seq
MIRT793593	hsa-miR-4793-3p	CLIP-seq
MIRT2443905	hsa-miR-548c-3p	CLIP-seq
MIRT2443906	hsa-miR-585	CLIP-seq
MIRT793609	hsa-miR-663	CLIP-seq
MIRT793610	hsa-miR-766	CLIP-seq
MIRT1934162	hsa-miR-1268	CLIP-seq
MIRT1934163	hsa-miR-1268b	CLIP-seq
MIRT2443901	hsa-miR-1537	CLIP-seq
MIRT793555	hsa-miR-1908	CLIP-seq
MIRT2477642	hsa-miR-1913	CLIP-seq
MIRT1934165	hsa-miR-3122	CLIP-seq
MIRT2477643	hsa-miR-3189-5p	CLIP-seq
MIRT2174032	hsa-miR-3197	CLIP-seq
MIRT2477644	hsa-miR-324-3p	CLIP-seq
MIRT2443902	hsa-miR-3613-3p	CLIP-seq
MIRT2174034	hsa-miR-3646	CLIP-seq
MIRT2477645	hsa-miR-3664-5p	CLIP-seq
MIRT1934167	hsa-miR-3689a-3p	CLIP-seq
MIRT1934168	hsa-miR-3689c	CLIP-seq
MIRT1934169	hsa-miR-3913-5p	CLIP-seq
MIRT2477646	hsa-miR-4433	CLIP-seq
MIRT2477647	hsa-miR-4459	CLIP-seq
MIRT2443903	hsa-miR-4486	CLIP-seq
MIRT2477648	hsa-miR-4683	CLIP-seq
MIRT2443904	hsa-miR-4684-5p	CLIP-seq
MIRT2477649	hsa-miR-4714-5p	CLIP-seq
MIRT1934171	hsa-miR-4728-5p	CLIP-seq
MIRT2477650	hsa-miR-4758-3p	CLIP-seq
MIRT2174040	hsa-miR-4767	CLIP-seq
MIRT2477651	hsa-miR-4768-3p	CLIP-seq
MIRT2443905	hsa-miR-548c-3p	CLIP-seq
MIRT2443906	hsa-miR-585	CLIP-seq
MIRT793609	hsa-miR-663	CLIP-seq
MIRT1934162	hsa-miR-1268	CLIP-seq
MIRT1934163	hsa-miR-1268b	CLIP-seq
MIRT2443901	hsa-miR-1537	CLIP-seq
MIRT1934165	hsa-miR-3122	CLIP-seq
MIRT2174032	hsa-miR-3197	CLIP-seq
MIRT2443902	hsa-miR-3613-3p	CLIP-seq
MIRT1934167	hsa-miR-3689a-3p	CLIP-seq
MIRT1934168	hsa-miR-3689c	CLIP-seq
MIRT1934169	hsa-miR-3913-5p	CLIP-seq
MIRT2477646	hsa-miR-4433	CLIP-seq
MIRT2477647	hsa-miR-4459	CLIP-seq
MIRT2477648	hsa-miR-4683	CLIP-seq
MIRT2443904	hsa-miR-4684-5p	CLIP-seq
MIRT1934171	hsa-miR-4728-5p	CLIP-seq
MIRT2174040	hsa-miR-4767	CLIP-seq
MIRT2477651	hsa-miR-4768-3p	CLIP-seq
MIRT2443905	hsa-miR-548c-3p	CLIP-seq

Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IDA	27957544
GO:0005096	Function	GTPase activator activity	IEA
GO:0005096	Function	GTPase activator activity	TAS
GO:0005634	Component	Nucleus	IDA	31883789
GO:0005634	Component	Nucleus	IEA
GO:0005829	Component	Cytosol	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0043547	Process	Positive regulation of GTPase activity	IDA	27957544
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	TAS

MIM	HGNC	e!Ensembl
610589	15783	ENSG00000198826

Q6P4F7

Protein name

Rho GTPase-activating protein 11A (Rho-type GTPase-activating protein 11A)

Protein function

GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.

PDB

3EAP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00620	RhoGAP	66 → 213	RhoGAP domain	Domain

Sequence

MWDQRLVRLALLQHLRAFYGIKVKGVRGQCDRRRHETAATEIGGKIFGVPFNALPHSAVP
EYGHIPSFLVDACTSLEDHIHTEGLFRKSGSVIRLKALKNKVDHGEGCLSSAPPCDIAGL
LKQFFRELPEPILPADLHEALLKAQQLGTEEKNKATLLLSCLLADHTVHVLRYFFNFLRN
VSLRSSENKMDSSNLAVIFAPNLLQTSEGHEKMSSNTEKKLRLQAAVVQTLIDYASDIGR
VPDFILEKIPAMLGIDGLCATPSLEGFEEGEYETPGEYKRKRRQSVGDFVSGALNKFKPN
RTPSITPQEERIAQLSESPVILTPNAKRTLPVDSSHGFSSKKRKSIKHNFNFELLPSNLF
NSSSTPVSVHIDTSSEGSSQSSLSPVLIGGNHLITAGVPRRSKRIAGKKVCRVESGKAGC
FSPKISHKEKVRRSLRLKFNLGKNGREVNGCSGVNRYESVGWRLANQQSLKNRIESVKTG
LLFSPDVDEKLPKKGSEKISKSEETLLTPERLVGTNYRMSWTGPNNSSFQEVDANEASSM
VENLEVENSLEPDIMVEKSPATSCELTPSNLNNKHNSNITSSPLSGDENNMTKETLVKVQ
KAFSESGSNLHALMNQRQSSVTNVGKVKLTEPSYLEDSPEENLFETNDLTIVESKEKYEH
HTGKGEKCFSERDFSPLQTQTFNRETTIKCYSTQMKMEHEKDIHSNMPKDYLSKQEFSSD
EEIKKQQSPKDKLNNKLKENENMMEGNLPKCAAHSKDEARSSFSQQSTCVVTNLSKPRPM
RIAKQQSLETCEKTVSESSQMTEHRKVSDHIQWFNKLSLNEPNRIKVKSPLKFQRTPVRQ
SVRRINSLLEYSRQPTGHKLASLGDTASPLVKSVSCDGALSSCIESASKDSSVSCIKSGP
KEQKSMSCEESNIGAISKSSMELPSKSFLKMRKHPDSVNASLRSTTVYKQKILSDGQVKV
PLDDLTNHDIVKPVVNNNMGISSGINNRVLRRPSERGRAWYKGSPKHPIGKTQLLPTSKP
VDL

Sequence length

1023

Interactions

View interactions

	Reactome
			Rho GTPase cycle

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (20)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	26417591	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26210741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26210741, 38046902	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27216196	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	38046902	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30545369	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37175461	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24386239	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	33859719	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	37175461	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	17163532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30545369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26210741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24386239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	24386239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	17163532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	35022380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35754342	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ARHGAP11A (Rho GTPase activating protein 11A)