Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	9806
Gene name	SPARC (osteonectin), cwcv and kazal like domains proteoglycan 2
Gene symbol	SPOCK2
Synonyms (NCBI Gene)	testican-2
Chromosome	10
Chromosome location	10q22.1
Summary	This gene encodes a protein which binds with glycosaminoglycans to form part of the extracellular matrix. The protein contains thyroglobulin type-1, follistatin-like, and calcium-binding domains, and has glycosaminoglycan attachment sites in the acidic C-

123

Show/Hide all (123)

miRTarBase ID	miRNA	Experiments	Reference
MIRT622130	hsa-miR-8485	HITS-CLIP	23824327
MIRT622129	hsa-miR-603	HITS-CLIP	23824327
MIRT622128	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT622127	hsa-miR-4643	HITS-CLIP	23824327
MIRT622126	hsa-miR-3941	HITS-CLIP	23824327
MIRT622130	hsa-miR-8485	HITS-CLIP	23824327
MIRT622129	hsa-miR-603	HITS-CLIP	23824327
MIRT622128	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT622127	hsa-miR-4643	HITS-CLIP	23824327
MIRT622126	hsa-miR-3941	HITS-CLIP	23824327
MIRT726465	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT726464	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT726463	hsa-miR-32-5p	HITS-CLIP	22473208
MIRT734119	hsa-miR-363-3p	Microarray	31794425
MIRT622130	hsa-miR-8485	HITS-CLIP	23824327
MIRT622129	hsa-miR-603	HITS-CLIP	23824327
MIRT622128	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT622127	hsa-miR-4643	HITS-CLIP	23824327
MIRT622126	hsa-miR-3941	HITS-CLIP	23824327
MIRT622130	hsa-miR-8485	HITS-CLIP	23824327
MIRT622129	hsa-miR-603	HITS-CLIP	23824327
MIRT622128	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT622127	hsa-miR-4643	HITS-CLIP	23824327
MIRT622126	hsa-miR-3941	HITS-CLIP	23824327
MIRT1385102	hsa-miR-1229	CLIP-seq
MIRT1385103	hsa-miR-1287	CLIP-seq
MIRT1385104	hsa-miR-1321	CLIP-seq
MIRT1385105	hsa-miR-224	CLIP-seq
MIRT1385106	hsa-miR-3614-5p	CLIP-seq
MIRT1385107	hsa-miR-3652	CLIP-seq
MIRT1385108	hsa-miR-4419a	CLIP-seq
MIRT1385109	hsa-miR-4430	CLIP-seq
MIRT1385110	hsa-miR-4505	CLIP-seq
MIRT1385111	hsa-miR-4510	CLIP-seq
MIRT1385112	hsa-miR-4729	CLIP-seq
MIRT1385113	hsa-miR-4739	CLIP-seq
MIRT1385114	hsa-miR-4756-5p	CLIP-seq
MIRT1385115	hsa-miR-4785	CLIP-seq
MIRT1385116	hsa-miR-647	CLIP-seq
MIRT1385117	hsa-miR-1249	CLIP-seq
MIRT1385118	hsa-miR-1912	CLIP-seq
MIRT1385119	hsa-miR-3064-3p	CLIP-seq
MIRT1385120	hsa-miR-329	CLIP-seq
MIRT1385121	hsa-miR-362-3p	CLIP-seq
MIRT1385122	hsa-miR-3667-5p	CLIP-seq
MIRT1385123	hsa-miR-370	CLIP-seq
MIRT1385124	hsa-miR-4270	CLIP-seq
MIRT1385125	hsa-miR-4423-5p	CLIP-seq
MIRT1385126	hsa-miR-4441	CLIP-seq
MIRT1385127	hsa-miR-4632	CLIP-seq
MIRT1385128	hsa-miR-4763-5p	CLIP-seq
MIRT1385129	hsa-miR-4768-3p	CLIP-seq
MIRT1385130	hsa-miR-767-3p	CLIP-seq
MIRT1554109	hsa-miR-3179	CLIP-seq
MIRT1554110	hsa-miR-4323	CLIP-seq
MIRT1554111	hsa-miR-4761-3p	CLIP-seq
MIRT2115229	hsa-miR-1193	CLIP-seq
MIRT2115230	hsa-miR-1207-3p	CLIP-seq
MIRT2115231	hsa-miR-1237	CLIP-seq
MIRT2115232	hsa-miR-1243	CLIP-seq
MIRT2115233	hsa-miR-1248	CLIP-seq
MIRT2115234	hsa-miR-1275	CLIP-seq
MIRT2115235	hsa-miR-1293	CLIP-seq
MIRT2115236	hsa-miR-1302	CLIP-seq
MIRT2115237	hsa-miR-136	CLIP-seq
MIRT1385118	hsa-miR-1912	CLIP-seq
MIRT2115238	hsa-miR-1915	CLIP-seq
MIRT2115239	hsa-miR-1972	CLIP-seq
MIRT2115240	hsa-miR-1976	CLIP-seq
MIRT2115241	hsa-miR-2115	CLIP-seq
MIRT2115242	hsa-miR-3155	CLIP-seq
MIRT2115243	hsa-miR-3155b	CLIP-seq
MIRT1554109	hsa-miR-3179	CLIP-seq
MIRT2115244	hsa-miR-361-3p	CLIP-seq
MIRT2115245	hsa-miR-3620	CLIP-seq
MIRT1385123	hsa-miR-370	CLIP-seq
MIRT2115246	hsa-miR-377	CLIP-seq
MIRT2115247	hsa-miR-4267	CLIP-seq
MIRT2115248	hsa-miR-4269	CLIP-seq
MIRT2115249	hsa-miR-4298	CLIP-seq
MIRT1554110	hsa-miR-4323	CLIP-seq
MIRT2115250	hsa-miR-4447	CLIP-seq
MIRT2115251	hsa-miR-4472	CLIP-seq
MIRT2115252	hsa-miR-4483	CLIP-seq
MIRT2115253	hsa-miR-4525	CLIP-seq
MIRT2115254	hsa-miR-4537	CLIP-seq
MIRT2115255	hsa-miR-4663	CLIP-seq
MIRT2115256	hsa-miR-4665-5p	CLIP-seq
MIRT2115257	hsa-miR-4668-5p	CLIP-seq
MIRT2115258	hsa-miR-4694-3p	CLIP-seq
MIRT2115259	hsa-miR-4723-5p	CLIP-seq
MIRT2115260	hsa-miR-4726-3p	CLIP-seq
MIRT1554111	hsa-miR-4761-3p	CLIP-seq
MIRT2115261	hsa-miR-484	CLIP-seq
MIRT2115262	hsa-miR-508-5p	CLIP-seq
MIRT2115263	hsa-miR-515-5p	CLIP-seq
MIRT2115264	hsa-miR-516a-3p	CLIP-seq
MIRT2115265	hsa-miR-570	CLIP-seq
MIRT2115266	hsa-miR-574-3p	CLIP-seq
MIRT2115267	hsa-miR-625	CLIP-seq
MIRT2115268	hsa-miR-665	CLIP-seq
MIRT2115269	hsa-miR-7	CLIP-seq
MIRT2115270	hsa-miR-766	CLIP-seq
MIRT2115229	hsa-miR-1193	CLIP-seq
MIRT2115232	hsa-miR-1243	CLIP-seq
MIRT2115234	hsa-miR-1275	CLIP-seq
MIRT2115235	hsa-miR-1293	CLIP-seq
MIRT2337993	hsa-miR-3151	CLIP-seq
MIRT2115250	hsa-miR-4447	CLIP-seq
MIRT2115251	hsa-miR-4472	CLIP-seq
MIRT2115252	hsa-miR-4483	CLIP-seq
MIRT2115253	hsa-miR-4525	CLIP-seq
MIRT2337994	hsa-miR-4640-5p	CLIP-seq
MIRT2115256	hsa-miR-4665-5p	CLIP-seq
MIRT2115257	hsa-miR-4668-5p	CLIP-seq
MIRT2115259	hsa-miR-4723-5p	CLIP-seq
MIRT2337995	hsa-miR-4726-5p	CLIP-seq
MIRT2115265	hsa-miR-570	CLIP-seq
MIRT2115267	hsa-miR-625	CLIP-seq
MIRT2691903	hsa-miR-3065-3p	CLIP-seq
MIRT2115244	hsa-miR-361-3p	CLIP-seq
MIRT2691904	hsa-miR-3913-3p	CLIP-seq
MIRT2691905	hsa-miR-489	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IDA	10386950
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005518	Function	Collagen binding	IBA
GO:0005539	Function	Glycosaminoglycan binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0007416	Process	Synapse assembly	NAS	10386950
GO:0008191	Function	Metalloendopeptidase inhibitor activity	IEA
GO:0008191	Function	Metalloendopeptidase inhibitor activity	TAS	12810672
GO:0010811	Process	Positive regulation of cell-substrate adhesion	IEA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0030198	Process	Extracellular matrix organization	NAS	10386950
GO:0031012	Component	Extracellular matrix	NAS	10386950
GO:0045595	Process	Regulation of cell differentiation	NAS	10386950
GO:0050840	Function	Extracellular matrix binding	IBA
GO:0050840	Function	Extracellular matrix binding	IEA
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:2000147	Process	Positive regulation of cell motility	TAS	12810672

MIM	HGNC	e!Ensembl
607988	13564	ENSG00000107742

Q92563

Protein name

Testican-2 (SPARC/osteonectin, CWCV, and Kazal-like domains proteoglycan 2)

Protein function

May participate in diverse steps of neurogenesis. Binds calcium.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07648	Kazal_2	131 → 180	Kazal-type serine protease inhibitor domain	Domain
PF10591	SPARC_Ca_bdg	196 → 305	Secreted protein acidic and rich in cysteine Ca binding region	Domain
PF00086	Thyroglobulin_1	313 → 376	Thyroglobulin type-1 repeat	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in brain. Also found in lung and testis. {ECO:0000269|PubMed:10386950}.

Sequence

MRAPGCGRLVLPLLLLAAAALAEGDAKGLKEGETPGNFMEDEQWLSSISQYSGKIKHWNR
FRDEVEDDYIKSWEDNQQGDEALDTTKDPCQKVKCSRHKVCIAQGYQRAMCISRKKLEHR
IKQPTVKLHGNKDSICKPCHMAQLASVCGSDGHTYSSVCKLEQQACLSSKQLAVRCEGPC
PCPTEQAATSTADGKPETCTGQDLADLGDRLRDWFQLLHENSKQNGSASSVAGPASGLDK
SLGASCKDSIGWMFSKLDTSADLFLDQTELAAINLDKYEVCIRPFFNSCDTYKDGRVSTA
EWCFCFWREKPPCLAELERIQIQEAAKKKPGIFIPSCDEDGYYRKMQCDQSSGDCWCVDQ
LGLELTGTRTHGSPDCDDIVGFSGDFGSGVGWEDEEEKETEEAGEEAEEEEGEAGEADDG
GYIW

Sequence length

424

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERVERTEBRAL DISC DISPLACEMENT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (23)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	21470430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18446232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	21836138, 28103583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	GWASDB_DG	21836138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	33761652	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	37188984	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31794425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18446232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	30832559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	32851893	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	12810672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	37841281	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	30832559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	31794425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31338255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18446232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	25298284	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	31794425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31794425, 36193300	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31338255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18446232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	28103583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	38157249	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SPOCK2 (SPARC (osteonectin), cwcv and kazal like domains proteoglycan 2)