Gene Gene information from NCBI Gene database.
Entrez ID 9805
Gene name Secernin 1
Gene symbol SCRN1
Synonyms (NCBI Gene)
SES1
Chromosome 7
Chromosome location 7p14.3
Summary This gene likely encodes a member of the secernin family of proteins. A similar protein in rat functions in regulation of exocytosis in mast cells. Alternatively spliced transcript variants have been described. [provided by RefSeq, Mar 2009]
miRNA miRNA information provided by mirtarbase database.
887
miRTarBase ID miRNA Experiments Reference
MIRT031060 hsa-miR-21-5p Microarray 18591254
MIRT032457 hsa-let-7b-5p Proteomics 18668040
MIRT050057 hsa-miR-26a-5p CLASH 23622248
MIRT036155 hsa-miR-320c CLASH 23622248
MIRT447929 hsa-miR-4426 PAR-CLIP 22100165
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 28514442, 32296183, 32812023, 32814053, 33961781, 35063084
GO:0005634 Component Nucleus IDA 10942595
GO:0005737 Component Cytoplasm IEA
GO:0006508 Process Proteolysis IEA
GO:0006887 Process Exocytosis IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
614965 22192 ENSG00000136193
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q12765
Protein name Secernin-1
Protein function Regulates exocytosis in mast cells. Increases both the extent of secretion and the sensitivity of mast cells to stimulation with calcium (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03577 Peptidase_C69 34 234 Peptidase family C69 Family
Sequence
MAAAPPSYCFVAFPPRAKDGLVVFGKNSARPRDEVQEVVYFSAADHEPESKVECTYISID
QVPRTYAIMISRPAWLWGAEMGANEHGVCIANEAINTREPAAEIEALLGMDLVRLGLERG
ETAKEALDVIVSLLEEHGQGGNYFEDANSCHSFQSAYLIVDRDEAWVLETIGKYWAAEKV
TEGVRCICSQLSLTTKMDAEHPELRSYAQSQGWWTGEGEFNFSEVFSPVEDHLD
CGAGKD
SLEKQEESITVQTMMNTLRDKASGVCIDSEFFLTTASGVSVLPQNRSSPCIHYFTGTPDP
SRSIFKPFIFVDDVKLVPKTQSPCFGDDDPAKKEPRFQEKPDRRHELYKAHEWARAIIES
DQEQGRKLRSTMLELEKQGLEAMEEILTSSEPLDPAEVGDLFYDCVDTEIKFFK
Sequence length 414
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
5
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
OBESITY GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Prostate cancer Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
PSORIASIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Breast Neoplasms Breast neoplasm Pubtator 24098497 Associate
★☆☆☆☆
Found in Text Mining only
Cerebral hemorrhage with amyloidosis, hereditary, Dutch type Cerebral Amyloid Angiopathy BEFREE 31796108
★☆☆☆☆
Found in Text Mining only
Colon Carcinoma Colon Carcinoma BEFREE 21220475, 25814779
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer BEFREE 20039278
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 25814779 Stimulate
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 37691034 Associate
★☆☆☆☆
Found in Text Mining only
Corticobasal degeneration Corticobasal Degeneration BEFREE 31796108
★☆☆☆☆
Found in Text Mining only
Degenerative polyarthritis Arthritis CTD_human_DG 18784066
★☆☆☆☆
Found in Text Mining only
Down Syndrome Down Syndrome BEFREE 31796108
★☆☆☆☆
Found in Text Mining only
Dry Eye Syndromes Dry Eye Syndromes BEFREE 30067536
★☆☆☆☆
Found in Text Mining only