BMS1 (BMS1 ribosome biogenesis factor)

Gene

• Entrez ID: 9790
• Gene name: BMS1 ribosome biogenesis factor
• Gene symbol: BMS1
• Synonyms (NCBI Gene): ACC, BMS1L
• Chromosome: 10
• Chromosome location: 10q11.21
• Summary: This gene likely encodes a ribosome assembly protein. A similar protein in yeast functions in 35S-rRNA processing, which includes a series of cleavage steps critical for formation of 40S ribosomes. Related pseudogenes exist on chromosomes 2, 9, 10, 15, 16

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs587777706	G>A	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT028582	hsa-miR-30a-5p	Proteomics	18668040
MIRT031746	hsa-miR-16-5p	Proteomics	18668040
MIRT042134	hsa-miR-484	CLASH	23622248
MIRT036128	hsa-miR-1296-5p	CLASH	23622248
MIRT635327	hsa-miR-2681-3p	HITS-CLIP	23824327
MIRT635326	hsa-miR-96-3p	HITS-CLIP	23824327
MIRT635325	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT635324	hsa-miR-3135b	HITS-CLIP	23824327
MIRT635323	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT635322	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT635321	hsa-miR-3652	HITS-CLIP	23824327
MIRT635320	hsa-miR-4430	HITS-CLIP	23824327
MIRT635319	hsa-miR-3907	HITS-CLIP	23824327
MIRT635318	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT635317	hsa-miR-5698	HITS-CLIP	23824327
MIRT635327	hsa-miR-2681-3p	HITS-CLIP	23824327
MIRT635326	hsa-miR-96-3p	HITS-CLIP	23824327
MIRT635325	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT635324	hsa-miR-3135b	HITS-CLIP	23824327
MIRT635323	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT635322	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT635321	hsa-miR-3652	HITS-CLIP	23824327
MIRT635320	hsa-miR-4430	HITS-CLIP	23824327
MIRT635319	hsa-miR-3907	HITS-CLIP	23824327
MIRT635318	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT635317	hsa-miR-5698	HITS-CLIP	23824327
MIRT528253	hsa-miR-511-3p	PAR-CLIP	22012620
MIRT528252	hsa-miR-4793-5p	PAR-CLIP	22012620
MIRT528251	hsa-miR-219b-5p	PAR-CLIP	22012620
MIRT528250	hsa-miR-508-3p	PAR-CLIP	22012620
MIRT528249	hsa-miR-219a-5p	PAR-CLIP	22012620
MIRT528248	hsa-miR-4782-3p	PAR-CLIP	22012620
MIRT528247	hsa-miR-6766-3p	PAR-CLIP	22012620
MIRT528246	hsa-miR-4445-5p	PAR-CLIP	22012620
MIRT528245	hsa-miR-505-3p	PAR-CLIP	22012620
MIRT635327	hsa-miR-2681-3p	HITS-CLIP	23824327
MIRT635326	hsa-miR-96-3p	HITS-CLIP	23824327
MIRT635325	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT635324	hsa-miR-3135b	HITS-CLIP	23824327
MIRT635323	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT635322	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT635321	hsa-miR-3652	HITS-CLIP	23824327
MIRT635320	hsa-miR-4430	HITS-CLIP	23824327
MIRT635319	hsa-miR-3907	HITS-CLIP	23824327
MIRT635318	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT635317	hsa-miR-5698	HITS-CLIP	23824327
MIRT635327	hsa-miR-2681-3p	HITS-CLIP	23824327
MIRT635326	hsa-miR-96-3p	HITS-CLIP	23824327
MIRT635325	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT635324	hsa-miR-3135b	HITS-CLIP	23824327
MIRT635323	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT635322	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT635321	hsa-miR-3652	HITS-CLIP	23824327
MIRT635320	hsa-miR-4430	HITS-CLIP	23824327
MIRT635319	hsa-miR-3907	HITS-CLIP	23824327
MIRT635318	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT635317	hsa-miR-5698	HITS-CLIP	23824327
MIRT528253	hsa-miR-511-3p	PAR-CLIP	22012620
MIRT528252	hsa-miR-4793-5p	PAR-CLIP	22012620
MIRT528251	hsa-miR-219b-5p	PAR-CLIP	22012620
MIRT528250	hsa-miR-508-3p	PAR-CLIP	22012620
MIRT528249	hsa-miR-219a-5p	PAR-CLIP	22012620
MIRT528248	hsa-miR-4782-3p	PAR-CLIP	22012620
MIRT528247	hsa-miR-6766-3p	PAR-CLIP	22012620
MIRT528246	hsa-miR-4445-5p	PAR-CLIP	22012620
MIRT528245	hsa-miR-505-3p	PAR-CLIP	22012620
MIRT823160	hsa-miR-1	CLIP-seq
MIRT823161	hsa-miR-1184	CLIP-seq
MIRT823162	hsa-miR-1207-3p	CLIP-seq
MIRT823163	hsa-miR-1264	CLIP-seq
MIRT823164	hsa-miR-1272	CLIP-seq
MIRT823165	hsa-miR-1322	CLIP-seq
MIRT823166	hsa-miR-150	CLIP-seq
MIRT823167	hsa-miR-1827	CLIP-seq
MIRT823168	hsa-miR-206	CLIP-seq
MIRT823169	hsa-miR-216a	CLIP-seq
MIRT823170	hsa-miR-216b	CLIP-seq
MIRT823171	hsa-miR-219-5p	CLIP-seq
MIRT823172	hsa-miR-24	CLIP-seq
MIRT823173	hsa-miR-2467-3p	CLIP-seq
MIRT823174	hsa-miR-28-3p	CLIP-seq
MIRT823175	hsa-miR-296-5p	CLIP-seq
MIRT823176	hsa-miR-3123	CLIP-seq
MIRT823177	hsa-miR-3125	CLIP-seq
MIRT823178	hsa-miR-3130-5p	CLIP-seq
MIRT823179	hsa-miR-3152-3p	CLIP-seq
MIRT823180	hsa-miR-3159	CLIP-seq
MIRT823181	hsa-miR-3163	CLIP-seq
MIRT823182	hsa-miR-320a	CLIP-seq
MIRT823183	hsa-miR-320b	CLIP-seq
MIRT823184	hsa-miR-320c	CLIP-seq
MIRT823185	hsa-miR-320d	CLIP-seq
MIRT823186	hsa-miR-340	CLIP-seq
MIRT823187	hsa-miR-3616-5p	CLIP-seq
MIRT823188	hsa-miR-3622b-5p	CLIP-seq
MIRT823189	hsa-miR-3647-5p	CLIP-seq
MIRT823190	hsa-miR-3673	CLIP-seq
MIRT823191	hsa-miR-3916	CLIP-seq
MIRT823192	hsa-miR-3941	CLIP-seq
MIRT823193	hsa-miR-425	CLIP-seq
MIRT823194	hsa-miR-4255	CLIP-seq
MIRT823195	hsa-miR-4257	CLIP-seq
MIRT823196	hsa-miR-4284	CLIP-seq
MIRT823197	hsa-miR-4310	CLIP-seq
MIRT823198	hsa-miR-433	CLIP-seq
MIRT823199	hsa-miR-4418	CLIP-seq
MIRT823200	hsa-miR-4429	CLIP-seq
MIRT823201	hsa-miR-4445	CLIP-seq
MIRT823202	hsa-miR-4482	CLIP-seq
MIRT823203	hsa-miR-4509	CLIP-seq
MIRT823204	hsa-miR-4514	CLIP-seq
MIRT823205	hsa-miR-4530	CLIP-seq
MIRT823206	hsa-miR-4639-3p	CLIP-seq
MIRT823207	hsa-miR-466	CLIP-seq
MIRT823208	hsa-miR-4672	CLIP-seq
MIRT823209	hsa-miR-4692	CLIP-seq
MIRT823210	hsa-miR-4714-3p	CLIP-seq
MIRT823211	hsa-miR-4719	CLIP-seq
MIRT823212	hsa-miR-4731-3p	CLIP-seq
MIRT823213	hsa-miR-4744	CLIP-seq
MIRT823214	hsa-miR-4760-3p	CLIP-seq
MIRT823215	hsa-miR-4777-3p	CLIP-seq
MIRT823216	hsa-miR-4795-5p	CLIP-seq
MIRT823217	hsa-miR-4801	CLIP-seq
MIRT823218	hsa-miR-509-3-5p	CLIP-seq
MIRT823219	hsa-miR-509-5p	CLIP-seq
MIRT823220	hsa-miR-548a-5p	CLIP-seq
MIRT823221	hsa-miR-548ab	CLIP-seq
MIRT823222	hsa-miR-548ak	CLIP-seq
MIRT823223	hsa-miR-548b-5p	CLIP-seq
MIRT823224	hsa-miR-548c-3p	CLIP-seq
MIRT823225	hsa-miR-548c-5p	CLIP-seq
MIRT823226	hsa-miR-548d-5p	CLIP-seq
MIRT823227	hsa-miR-548h	CLIP-seq
MIRT823228	hsa-miR-548i	CLIP-seq
MIRT823229	hsa-miR-548j	CLIP-seq
MIRT823230	hsa-miR-548w	CLIP-seq
MIRT823231	hsa-miR-548y	CLIP-seq
MIRT823232	hsa-miR-552	CLIP-seq
MIRT823233	hsa-miR-559	CLIP-seq
MIRT823234	hsa-miR-573	CLIP-seq
MIRT823235	hsa-miR-580	CLIP-seq
MIRT823236	hsa-miR-592	CLIP-seq
MIRT823237	hsa-miR-597	CLIP-seq
MIRT823238	hsa-miR-613	CLIP-seq
MIRT823239	hsa-miR-642b	CLIP-seq
MIRT823240	hsa-miR-646	CLIP-seq
MIRT823241	hsa-miR-668	CLIP-seq
MIRT823242	hsa-miR-892a	CLIP-seq
MIRT823243	hsa-miR-940	CLIP-seq
MIRT823161	hsa-miR-1184	CLIP-seq
MIRT1943397	hsa-miR-1208	CLIP-seq
MIRT1943398	hsa-miR-122	CLIP-seq
MIRT1943399	hsa-miR-1245	CLIP-seq
MIRT1943400	hsa-miR-1343	CLIP-seq
MIRT823166	hsa-miR-150	CLIP-seq
MIRT1943401	hsa-miR-2392	CLIP-seq
MIRT823172	hsa-miR-24	CLIP-seq
MIRT1943402	hsa-miR-2681	CLIP-seq
MIRT823179	hsa-miR-3152-3p	CLIP-seq
MIRT1943403	hsa-miR-371-5p	CLIP-seq
MIRT823192	hsa-miR-3941	CLIP-seq
MIRT823196	hsa-miR-4284	CLIP-seq
MIRT1943404	hsa-miR-431	CLIP-seq
MIRT1943405	hsa-miR-4330	CLIP-seq
MIRT823199	hsa-miR-4418	CLIP-seq
MIRT1943406	hsa-miR-4464	CLIP-seq
MIRT823206	hsa-miR-4639-3p	CLIP-seq
MIRT823207	hsa-miR-466	CLIP-seq
MIRT823208	hsa-miR-4672	CLIP-seq
MIRT1943407	hsa-miR-4704-3p	CLIP-seq
MIRT823210	hsa-miR-4714-3p	CLIP-seq
MIRT1943408	hsa-miR-4726-3p	CLIP-seq
MIRT1943409	hsa-miR-4748	CLIP-seq
MIRT823218	hsa-miR-509-3-5p	CLIP-seq
MIRT823219	hsa-miR-509-5p	CLIP-seq
MIRT823242	hsa-miR-892a	CLIP-seq
MIRT2182046	hsa-miR-106a	CLIP-seq
MIRT2182047	hsa-miR-106b	CLIP-seq
MIRT823161	hsa-miR-1184	CLIP-seq
MIRT823162	hsa-miR-1207-3p	CLIP-seq
MIRT1943398	hsa-miR-122	CLIP-seq
MIRT823163	hsa-miR-1264	CLIP-seq
MIRT1943400	hsa-miR-1343	CLIP-seq
MIRT2182048	hsa-miR-140-3p	CLIP-seq
MIRT823166	hsa-miR-150	CLIP-seq
MIRT2182049	hsa-miR-17	CLIP-seq
MIRT823167	hsa-miR-1827	CLIP-seq
MIRT2182050	hsa-miR-1976	CLIP-seq
MIRT2182051	hsa-miR-20a	CLIP-seq
MIRT2182052	hsa-miR-20b	CLIP-seq
MIRT823169	hsa-miR-216a	CLIP-seq
MIRT823170	hsa-miR-216b	CLIP-seq
MIRT1943401	hsa-miR-2392	CLIP-seq
MIRT823172	hsa-miR-24	CLIP-seq
MIRT823173	hsa-miR-2467-3p	CLIP-seq
MIRT1943402	hsa-miR-2681	CLIP-seq
MIRT823176	hsa-miR-3123	CLIP-seq
MIRT823177	hsa-miR-3125	CLIP-seq
MIRT823179	hsa-miR-3152-3p	CLIP-seq
MIRT823182	hsa-miR-320a	CLIP-seq
MIRT823183	hsa-miR-320b	CLIP-seq
MIRT823184	hsa-miR-320c	CLIP-seq
MIRT823185	hsa-miR-320d	CLIP-seq
MIRT2182053	hsa-miR-324-5p	CLIP-seq
MIRT823191	hsa-miR-3916	CLIP-seq
MIRT2182054	hsa-miR-3934	CLIP-seq
MIRT823194	hsa-miR-4255	CLIP-seq
MIRT2182055	hsa-miR-4269	CLIP-seq
MIRT823196	hsa-miR-4284	CLIP-seq
MIRT823199	hsa-miR-4418	CLIP-seq
MIRT823200	hsa-miR-4429	CLIP-seq
MIRT823203	hsa-miR-4509	CLIP-seq
MIRT823204	hsa-miR-4514	CLIP-seq
MIRT2182056	hsa-miR-4649-3p	CLIP-seq
MIRT823209	hsa-miR-4692	CLIP-seq
MIRT1943407	hsa-miR-4704-3p	CLIP-seq
MIRT823210	hsa-miR-4714-3p	CLIP-seq
MIRT2182057	hsa-miR-4722-3p	CLIP-seq
MIRT2182058	hsa-miR-4733-5p	CLIP-seq
MIRT823213	hsa-miR-4744	CLIP-seq
MIRT2182059	hsa-miR-499-3p	CLIP-seq
MIRT2182060	hsa-miR-499a-3p	CLIP-seq
MIRT823218	hsa-miR-509-3-5p	CLIP-seq
MIRT823219	hsa-miR-509-5p	CLIP-seq
MIRT2182061	hsa-miR-519d	CLIP-seq
MIRT2182062	hsa-miR-520g	CLIP-seq
MIRT2182063	hsa-miR-520h	CLIP-seq
MIRT823220	hsa-miR-548a-5p	CLIP-seq
MIRT823221	hsa-miR-548ab	CLIP-seq
MIRT823222	hsa-miR-548ak	CLIP-seq
MIRT823223	hsa-miR-548b-5p	CLIP-seq
MIRT823225	hsa-miR-548c-5p	CLIP-seq
MIRT823226	hsa-miR-548d-5p	CLIP-seq
MIRT823227	hsa-miR-548h	CLIP-seq
MIRT823228	hsa-miR-548i	CLIP-seq
MIRT823229	hsa-miR-548j	CLIP-seq
MIRT823230	hsa-miR-548w	CLIP-seq
MIRT823231	hsa-miR-548y	CLIP-seq
MIRT823232	hsa-miR-552	CLIP-seq
MIRT823233	hsa-miR-559	CLIP-seq
MIRT823235	hsa-miR-580	CLIP-seq
MIRT823240	hsa-miR-646	CLIP-seq
MIRT823242	hsa-miR-892a	CLIP-seq
MIRT2182064	hsa-miR-93	CLIP-seq
MIRT823243	hsa-miR-940	CLIP-seq
MIRT823161	hsa-miR-1184	CLIP-seq
MIRT2384836	hsa-miR-1205	CLIP-seq
MIRT823164	hsa-miR-1272	CLIP-seq
MIRT823165	hsa-miR-1322	CLIP-seq
MIRT2182050	hsa-miR-1976	CLIP-seq
MIRT823172	hsa-miR-24	CLIP-seq
MIRT1943402	hsa-miR-2681	CLIP-seq
MIRT823179	hsa-miR-3152-3p	CLIP-seq
MIRT823192	hsa-miR-3941	CLIP-seq
MIRT2182055	hsa-miR-4269	CLIP-seq
MIRT823196	hsa-miR-4284	CLIP-seq
MIRT823199	hsa-miR-4418	CLIP-seq
MIRT823206	hsa-miR-4639-3p	CLIP-seq
MIRT823207	hsa-miR-466	CLIP-seq
MIRT823208	hsa-miR-4672	CLIP-seq
MIRT823212	hsa-miR-4731-3p	CLIP-seq
MIRT823217	hsa-miR-4801	CLIP-seq
MIRT823218	hsa-miR-509-3-5p	CLIP-seq
MIRT823219	hsa-miR-509-5p	CLIP-seq
MIRT823241	hsa-miR-668	CLIP-seq
MIRT823242	hsa-miR-892a	CLIP-seq
MIRT2485566	hsa-miR-1182	CLIP-seq
MIRT823161	hsa-miR-1184	CLIP-seq
MIRT1943398	hsa-miR-122	CLIP-seq
MIRT2182048	hsa-miR-140-3p	CLIP-seq
MIRT2485567	hsa-miR-146b-3p	CLIP-seq
MIRT823167	hsa-miR-1827	CLIP-seq
MIRT2485568	hsa-miR-193a-5p	CLIP-seq
MIRT823172	hsa-miR-24	CLIP-seq
MIRT823173	hsa-miR-2467-3p	CLIP-seq
MIRT1943402	hsa-miR-2681	CLIP-seq
MIRT823176	hsa-miR-3123	CLIP-seq
MIRT823177	hsa-miR-3125	CLIP-seq
MIRT823178	hsa-miR-3130-5p	CLIP-seq
MIRT2485569	hsa-miR-3157-3p	CLIP-seq
MIRT2485570	hsa-miR-3173-5p	CLIP-seq
MIRT2485571	hsa-miR-339-5p	CLIP-seq
MIRT2485572	hsa-miR-3691-3p	CLIP-seq
MIRT823191	hsa-miR-3916	CLIP-seq
MIRT823196	hsa-miR-4284	CLIP-seq
MIRT1943404	hsa-miR-431	CLIP-seq
MIRT2485573	hsa-miR-4323	CLIP-seq
MIRT823199	hsa-miR-4418	CLIP-seq
MIRT823202	hsa-miR-4482	CLIP-seq
MIRT823204	hsa-miR-4514	CLIP-seq
MIRT823205	hsa-miR-4530	CLIP-seq
MIRT823209	hsa-miR-4692	CLIP-seq
MIRT2485574	hsa-miR-494	CLIP-seq
MIRT2182059	hsa-miR-499-3p	CLIP-seq
MIRT2182060	hsa-miR-499a-3p	CLIP-seq
MIRT823218	hsa-miR-509-3-5p	CLIP-seq
MIRT823219	hsa-miR-509-5p	CLIP-seq
MIRT823220	hsa-miR-548a-5p	CLIP-seq
MIRT823221	hsa-miR-548ab	CLIP-seq
MIRT823222	hsa-miR-548ak	CLIP-seq
MIRT823223	hsa-miR-548b-5p	CLIP-seq
MIRT823225	hsa-miR-548c-5p	CLIP-seq
MIRT823226	hsa-miR-548d-5p	CLIP-seq
MIRT823227	hsa-miR-548h	CLIP-seq
MIRT823228	hsa-miR-548i	CLIP-seq
MIRT823229	hsa-miR-548j	CLIP-seq
MIRT823230	hsa-miR-548w	CLIP-seq
MIRT823231	hsa-miR-548y	CLIP-seq
MIRT823233	hsa-miR-559	CLIP-seq
MIRT823235	hsa-miR-580	CLIP-seq
MIRT2485575	hsa-miR-874	CLIP-seq
MIRT823243	hsa-miR-940	CLIP-seq
MIRT823161	hsa-miR-1184	CLIP-seq
MIRT2182048	hsa-miR-140-3p	CLIP-seq
MIRT823167	hsa-miR-1827	CLIP-seq
MIRT823172	hsa-miR-24	CLIP-seq
MIRT823173	hsa-miR-2467-3p	CLIP-seq
MIRT1943402	hsa-miR-2681	CLIP-seq
MIRT823176	hsa-miR-3123	CLIP-seq
MIRT823177	hsa-miR-3125	CLIP-seq
MIRT823191	hsa-miR-3916	CLIP-seq
MIRT823196	hsa-miR-4284	CLIP-seq
MIRT2485573	hsa-miR-4323	CLIP-seq
MIRT823199	hsa-miR-4418	CLIP-seq
MIRT823204	hsa-miR-4514	CLIP-seq
MIRT823209	hsa-miR-4692	CLIP-seq
MIRT2182059	hsa-miR-499-3p	CLIP-seq
MIRT2182060	hsa-miR-499a-3p	CLIP-seq
MIRT823218	hsa-miR-509-3-5p	CLIP-seq
MIRT823219	hsa-miR-509-5p	CLIP-seq
MIRT823220	hsa-miR-548a-5p	CLIP-seq
MIRT823221	hsa-miR-548ab	CLIP-seq
MIRT823222	hsa-miR-548ak	CLIP-seq
MIRT823223	hsa-miR-548b-5p	CLIP-seq
MIRT823225	hsa-miR-548c-5p	CLIP-seq
MIRT823226	hsa-miR-548d-5p	CLIP-seq
MIRT823227	hsa-miR-548h	CLIP-seq
MIRT823228	hsa-miR-548i	CLIP-seq
MIRT823229	hsa-miR-548j	CLIP-seq
MIRT823230	hsa-miR-548w	CLIP-seq
MIRT823231	hsa-miR-548y	CLIP-seq
MIRT823233	hsa-miR-559	CLIP-seq
MIRT823243	hsa-miR-940	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000462	Process	Maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IBA
GO:0000479	Process	Endonucleolytic cleavage of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IBA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003924	Function	GTPase activity	IBA
GO:0005515	Function	Protein binding	IPI	33961781, 35271311
GO:0005524	Function	ATP binding	IEA
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005730	Component	Nucleolus	IEA
GO:0005730	Component	Nucleolus	ISS
GO:0016787	Function	Hydrolase activity	IEA
GO:0032040	Component	Small-subunit processome	IDA	34516797
GO:0032040	Component	Small-subunit processome	IEA
GO:0034511	Function	U3 snoRNA binding	IBA
GO:0042254	Process	Ribosome biogenesis	IEA
GO:0042274	Process	Ribosomal small subunit biogenesis	IDA	34516797
GO:0042274	Process	Ribosomal small subunit biogenesis	IEA

Other IDs

• MIM: 611448
• HGNC: 23505
• e!Ensembl: ENSG00000165733

Protein

• UniProt ID: Q14692
• Protein name: Ribosome biogenesis protein BMS1 homolog (EC 3.6.5.-) (Ribosome assembly protein BMS1 homolog)
• Protein function: GTPase required for the synthesis of 40S ribosomal subunits and for processing of pre-ribosomal RNA (pre-rRNA) at sites A0, A1, and A2. Controls access of pre-rRNA intermediates to RCL1 during ribosome biogenesis by binding RCL1 in a GTP-depende
• PDB: 7MQ9, 7MQA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08142	AARP2CN	231 → 316	AARP2CN (NUC121) domain	Domain
  PF04950	RIBIOP_C	814 → 1106	40S ribosome biogenesis protein Tsr1 and BMS1 C-terminal	Family

• Sequence:

  MEAKDQKKHRKKNSGPKAAKKKKRLLQDLQLGDEEDARKRNPKAFAVQSAVRMARSFHRT
  QDLKTKKHHIPVVDRTPLEPPPIVVVVMGPPKVGKSTLIQCLIRNFTRQKLTEIRGPVTI
  VSGKKRRLTIIECGCDINMMIDLAKVADLVLMLIDASFGFEMETFEFLNICQVHGFPKIM
  GVLTHLDSFKHNKQLKKTKKRLKHRFWTEVYPGAKLFYLSGMVHGEYQNQEIHNLGRFIT
  VMKFRPLTWQTSHPYILADRMEDLTNPEDIRTNIKCDRKVSLYGYLRGAHLKNKSQIHMP
  GVGDFAVSDISFLPDPCALPEQQKKRCLNEKEKLVYAPLSGVGGVLYDKDAVYVDLGGSH
  VFQDEVGPTHELVQSLISTHSTIDAKMASSRVTLFSDSKPLGSEDIDNQGLMMPKEEKQM
  DLNTGRMRRKAIFGDEDESGDSDDEEDDEMSEDDGLENGSSDEEAEEEENAEMTDQYMAV
  KGIKRRKLELEEDSEMDLPAFADSDDDLERSSAEEGEAEEADESSEEEDCTAGEKGISGS
  KAAGEGSKAGLSPANCQSDRVNLEKSLLMKKAALPTFDSGHCTAEEVFASEDESEESSSL
  SAEEEDSENEEAIRKKLSKPSQVSSGQKLGPQNFIDETSDIENLLKEEEDYKEENNDSKE
  TSGALKWKEDLSRKAAEAFLRQQQAAPNLRKLIYGTVTEDNEEEDDDTLEELGGLFRVNQ
  PDRECKHKADSLDCSRFLVEAPHDWDLEEVMNSIRDCFVTGKWEDDKDAAKVLAEDEELY
  GDFEDLETGDVHKGKSGPNTQNEDIEKEVKEEIDPDEEESAKKKHLDKKRKLKEMFDAEY
  DEGESTYFDDLKGEMQKQAQLNRAEFEDQDDEARVQYEGFRPGMYVRIEIENVPCEFVQN
  FDPHYPIILGGLGNSEGNVGYVQMRLKKHRWYKKILKSRDPIIFSVGWRRFQTIPLYYIE
  DHNGRQRLLKYTPQHMHCGAAFWGPITPQGTGFLAIQSVSGIMPDFRIAATGVVLDLDKS
  IKIVKKLKLTGFPYKIFKNTSFIKGMFNSALEVAKFEGAVIRTVSGIRGQIKKALRAPEG
  AFRASFEDKLLMSDIVFMRTWYPVSIPAFYNPVTSLLKPVGEKDTWSGMRTTGQLRLAHG
  VRLKANKDSLYKPILRQKKHFNSLHIPKALQKALPFKNKPKTQAKAGKVPKDRRRPAVIR
  EPHERKILALLDALSTVHSQKMKKAKEQRHLHNKEHFRAKQKEEEEKLKRQKDLRKKLFR
  IQGQKERRNQKSSLKGAEGQLQ

• Sequence length: 1282

Pathways

KEGG:

Ribosome biogenesis in eukaryotes

Reactome:

Major pathway of rRNA processing in the nucleolus and cytosol

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Aplasia cutis congenita	Pathogenic	rs587777706	RCV000144047	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
APLASIA CUTIS CONGENITA, NONSYNDROMIC	—	HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BMS1-related disorder	Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ECTODERMAL DYSPLASIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROGRESSIVE SUPRANUCLEAR PALSY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Ablepharon	Ablepharon	BEFREE	29869975		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	12781057, 26261681		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	16786124		★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	BEFREE	26446994, 28095038		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Neoplasms	Adrenal neoplasia	BEFREE	28095038		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	28332880		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	28095038, 28332880, 28614035, 30691340		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	10655994, 16131791, 26446994, 28173997, 30092300, 30903866, 31584213, 31645006, 7479776, 9288786		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	28713926		★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	BEFREE	8179602		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	9288786		★☆☆☆☆ Found in Text Mining only
Anhydrotic Ectodermal Dysplasias	Hypohidrotic ectodermal dysplasia	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	29980676, 31172616		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	26385612, 30935991, 31537795		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	26385612, 30935991, 31209172, 31537795		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	10655994, 16131791, 23785305, 26446994, 28173997, 30092300, 30903866, 31584213, 31645006, 7479776, 9288786		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Aplasia Cutis Congenita	Aplasia Cutis Congenita	UNIPROT_DG	23785305		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Aplasia Cutis Congenita	Aplasia Cutis Congenita	ORPHANET_DG	23785305		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Aplasia cutis congenita	Aplasia Cutis Congenita	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Aplasia Cutis Congenita	Aplasia Cutis Congenita	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Aplasia Cutis Congenita	Aplasia Cutis Congenita	CTD_human_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Aplasia cutis congenita over the scalp vertex	Aplasia Cutis Congenita	HPO_DG			★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	27437649		★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	29886733		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	9288786		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	27437649, 28330658, 28627235, 28878828, 29050979, 30571498, 30705337		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	28529874		★☆☆☆☆ Found in Text Mining only
Atypical Teratoid Rhabdoid Tumor	Teratoid Rhabdoid Tumor	BEFREE	15273111		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	30395694		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	25515860		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	30069426, 30130684		★☆☆☆☆ Found in Text Mining only
Bulimia	Bulimia	BEFREE	29558632		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12877803		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	7987312		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	27655643		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	29445083		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	28008158		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	27437649, 28687710, 28863213, 29050979, 30362921, 30367991, 30619912, 31140347		★☆☆☆☆ Found in Text Mining only
Central Core Myopathy (disorder)	Myopathy	BEFREE	14708096		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	21757917		★☆☆☆☆ Found in Text Mining only
Christ-Siemens-Touraine syndrome	Hypohidrotic Ectodermal Dysplasia, X-Linked	BEFREE	30846346		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	25049200		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30905361, 31492989		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	15142213		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28040840		★☆☆☆☆ Found in Text Mining only
Congenital localized absence of skin	Congenital localized absence of skin	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29667019		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	23507260, 28330658		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	31462608		★☆☆☆☆ Found in Text Mining only
Corpus callosum agenesis neuronopathy	Corpus Callosum Agenesis Neuronopathy	BEFREE	17893295, 18566107		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30260258		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	16984279, 30362921		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	16984279, 30362921, 31301219		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	12149601, 28863213, 9568693		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	31604978		★☆☆☆☆ Found in Text Mining only
Dysphoric mood	Mood Disorder	BEFREE	29549852		★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal Dysplasia	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ECTODERMAL DYSPLASIA 10B, HYPOHIDROTIC/HAIR/TOOTH TYPE, AUTOSOMAL RECESSIVE	Ectodermal Dysplasia	BEFREE	30846346		★☆☆☆☆ Found in Text Mining only
ECTODERMAL DYSPLASIA 11B, HYPOHIDROTIC/HAIR/TOOTH TYPE, AUTOSOMAL RECESSIVE	Ectodermal dysplasia	BEFREE	30846346		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	20618176		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	9809981		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	29336609		★☆☆☆☆ Found in Text Mining only
Facial paralysis	Facial paralysis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	31645659		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	16361810		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	8923835		★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	30205739		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	16945026		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	10651846		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29667019		★☆☆☆☆ Found in Text Mining only
Heart valve disease	Cardiac valvular disease	BEFREE	28420803		★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	26438404		★☆☆☆☆ Found in Text Mining only
Hidrotic Ectodermal Dysplasia	Hidrotic Ectodermal Dysplasia	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29677194		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	21295959		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28111356, 30371728, 30827526, 30905361, 30916719, 31011156, 31050695, 31382808, 31481243, 31521481		★☆☆☆☆ Found in Text Mining only
Hypertrichosis	HYPERTRICHOSIS	BEFREE	15126570		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	27901040		★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	27901040		★☆☆☆☆ Found in Text Mining only
Hypoplasia of corpus callosum	Hypoplasia Of Corpus Callosum	BEFREE	29902589		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	16361810		★☆☆☆☆ Found in Text Mining only
Incontinentia Pigmenti Achromians	Incontinentia Pigmenti Achromians	BEFREE	16247433		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	29748155		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	30905361		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	25049200		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	23966553		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	35859008	Associate	★☆☆☆☆ Found in Text Mining only
Lipid Metabolism Disorders	Lipid Metabolism Disorders	BEFREE	30702114		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30244972		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	17092253, 31694741		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	18201362		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	29896094, 30069426		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	9809981		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	24956286		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	7987312		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	27655643		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18974063, 29466694		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26520441, 30205739		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	24008415		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22266195, 26261681, 28332880, 28485162, 28848043		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30260258		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	22388865, 24201868		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	31454663		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	29889154		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	24118457		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	7906211		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	30077048		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12634399, 16630136, 16882496, 24008415, 26261681, 26768118, 29653784, 9288786		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	31439721		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28771824, 29790582, 31756344		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24973952, 27431200		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	19223519, 23805277, 31454663		★☆☆☆☆ Found in Text Mining only
Obsessive compulsive behavior	Obsessive-Compulsive Disorder	BEFREE	27876668		★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	27876668, 28529874		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	27655643		★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	28332880		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	11956967, 29869975		★☆☆☆☆ Found in Text Mining only
PEROXISOME BIOGENESIS DISORDER, COMPLEMENTATION GROUP A	Zellweger Syndrome	BEFREE	7479776, 9288786		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	28332880		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	30827526		★☆☆☆☆ Found in Text Mining only
Precocious Puberty	Precocious puberty	BEFREE	26940356		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18974063, 29466694		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	12944983		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	17235259		★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	BEFREE	26255050		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	18427872, 28254559, 30275258		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	19944766, 21658228, 24275578, 30035013, 30852397		★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	HPO_DG			★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	25577251		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29152143		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26520441, 30205739		★☆☆☆☆ Found in Text Mining only
Syndactyly of fingers	Syndactyly of fingers	HPO_DG			★☆☆☆☆ Found in Text Mining only
Syndactyly of the toes	Syndactyly Of The Toes	HPO_DG			★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	18493769		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	11039907		★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	BEFREE	30846346		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28008158		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	25247297		★☆☆☆☆ Found in Text Mining only