Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	9788
Gene name	MTSS I-BAR domain containing 1
Gene symbol	MTSS1
Synonyms (NCBI Gene)	MIMMIMAMIMB
Chromosome	8
Chromosome location	8q24.13

180

Show/Hide all (180)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006300	hsa-miR-182-5p	Luciferase reporter assay	22322863
MIRT006300	hsa-miR-182-5p	Luciferase reporter assay	22322863
MIRT006300	hsa-miR-182-5p	Luciferase reporter assay	22322863
MIRT006300	hsa-miR-182-5p	Luciferase reporter assay	22322863
MIRT006300	hsa-miR-182-5p	Luciferase reporter assay	22322863
MIRT006300	hsa-miR-182-5p	Luciferase reporter assay	22322863
MIRT006300	hsa-miR-182-5p	Luciferase reporter assay	22322863
MIRT006300	hsa-miR-182-5p	Luciferase reporter assay	22322863
MIRT006300	hsa-miR-182-5p	Luciferase reporter assay	22322863
MIRT006300	hsa-miR-182-5p	Luciferase reporter assay	22322863
MIRT006300	hsa-miR-182-5p	Luciferase reporter assay	22322863
MIRT006300	hsa-miR-182-5p	Luciferase reporter assay	22322863
MIRT006300	hsa-miR-182-5p	Luciferase reporter assay	22322863
MIRT006300	hsa-miR-182-5p	Luciferase reporter assay	22322863
MIRT006300	hsa-miR-182-5p	Luciferase reporter assay	22322863
MIRT006300	hsa-miR-182-5p	Luciferase reporter assay	22322863
MIRT006300	hsa-miR-182-5p	Luciferase reporter assay	22322863
MIRT006300	hsa-miR-182-5p	Luciferase reporter assay	22322863
MIRT006300	hsa-miR-182-5p	Luciferase reporter assay	22681717
MIRT006300	hsa-miR-182-5p	Luciferase reporter assay	22681717
MIRT006300	hsa-miR-182-5p	Luciferase reporter assay	22681717
MIRT006300	hsa-miR-182-5p	Luciferase reporter assay	22681717
MIRT006300	hsa-miR-182-5p	Luciferase reporter assay	23383207
MIRT024949	hsa-miR-215-5p	Microarray	19074876
MIRT026400	hsa-miR-192-5p	Microarray	19074876
MIRT006300	hsa-miR-182-5p	Luciferase reporter assay	23474751
MIRT054181	hsa-miR-135a-5p	Luciferase reporter assayqRT-PCRWestern blot	23017832
MIRT625747	hsa-miR-7-1-3p	HITS-CLIP	23824327
MIRT625746	hsa-miR-7-2-3p	HITS-CLIP	23824327
MIRT625745	hsa-miR-33a-3p	HITS-CLIP	23824327
MIRT625744	hsa-miR-5193	HITS-CLIP	23824327
MIRT625743	hsa-miR-3183	HITS-CLIP	23824327
MIRT625742	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT625741	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT625740	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT625739	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT625738	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT625737	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT732322	hsa-miR-96-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	2662933
MIRT732322	hsa-miR-96-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	2662933
MIRT735321	hsa-miR-21-3p	qRT-PCR	33290159
MIRT735323	hsa-miR-27a-3p	qRT-PCR	33290159
MIRT625747	hsa-miR-7-1-3p	HITS-CLIP	23824327
MIRT625746	hsa-miR-7-2-3p	HITS-CLIP	23824327
MIRT625745	hsa-miR-33a-3p	HITS-CLIP	23824327
MIRT625744	hsa-miR-5193	HITS-CLIP	23824327
MIRT625743	hsa-miR-3183	HITS-CLIP	23824327
MIRT625742	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT625741	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT625740	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT625739	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT625738	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT625737	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT006300	hsa-miR-182-5p	qRT-PCR	37887350
MIRT1165439	hsa-miR-1	CLIP-seq
MIRT1165440	hsa-miR-103a	CLIP-seq
MIRT1165441	hsa-miR-107	CLIP-seq
MIRT1165442	hsa-miR-1271	CLIP-seq
MIRT1165443	hsa-miR-127-5p	CLIP-seq
MIRT1165444	hsa-miR-135a	CLIP-seq
MIRT1165445	hsa-miR-135b	CLIP-seq
MIRT1165446	hsa-miR-15a	CLIP-seq
MIRT1165447	hsa-miR-15b	CLIP-seq
MIRT1165448	hsa-miR-16	CLIP-seq
MIRT1165449	hsa-miR-182	CLIP-seq
MIRT1165450	hsa-miR-1827	CLIP-seq
MIRT1165451	hsa-miR-195	CLIP-seq
MIRT1165452	hsa-miR-206	CLIP-seq
MIRT1165453	hsa-miR-223	CLIP-seq
MIRT1165454	hsa-miR-3140-3p	CLIP-seq
MIRT1165455	hsa-miR-3152-3p	CLIP-seq
MIRT1165456	hsa-miR-323-3p	CLIP-seq
MIRT1165457	hsa-miR-342-3p	CLIP-seq
MIRT1165458	hsa-miR-3673	CLIP-seq
MIRT1165459	hsa-miR-376c	CLIP-seq
MIRT1165460	hsa-miR-3929	CLIP-seq
MIRT1165461	hsa-miR-3938	CLIP-seq
MIRT1165462	hsa-miR-3975	CLIP-seq
MIRT1165463	hsa-miR-3976	CLIP-seq
MIRT1165464	hsa-miR-424	CLIP-seq
MIRT1165465	hsa-miR-4266	CLIP-seq
MIRT1165466	hsa-miR-4272	CLIP-seq
MIRT1165467	hsa-miR-4419a	CLIP-seq
MIRT1165468	hsa-miR-4419b	CLIP-seq
MIRT1165469	hsa-miR-4464	CLIP-seq
MIRT1165470	hsa-miR-4477a	CLIP-seq
MIRT1165471	hsa-miR-4478	CLIP-seq
MIRT1165472	hsa-miR-450b-5p	CLIP-seq
MIRT1165473	hsa-miR-4510	CLIP-seq
MIRT1165474	hsa-miR-4694-3p	CLIP-seq
MIRT1165475	hsa-miR-4695-5p	CLIP-seq
MIRT1165476	hsa-miR-4697-3p	CLIP-seq
MIRT1165477	hsa-miR-4699-3p	CLIP-seq
MIRT1165478	hsa-miR-4712-5p	CLIP-seq
MIRT1165479	hsa-miR-4714-3p	CLIP-seq
MIRT1165480	hsa-miR-4748	CLIP-seq
MIRT1165481	hsa-miR-4779	CLIP-seq
MIRT1165482	hsa-miR-497	CLIP-seq
MIRT1165483	hsa-miR-507	CLIP-seq
MIRT1165484	hsa-miR-513c	CLIP-seq
MIRT1165485	hsa-miR-514b-5p	CLIP-seq
MIRT1165486	hsa-miR-518a-5p	CLIP-seq
MIRT1165487	hsa-miR-520d-5p	CLIP-seq
MIRT1165488	hsa-miR-522	CLIP-seq
MIRT1165489	hsa-miR-524-5p	CLIP-seq
MIRT1165490	hsa-miR-527	CLIP-seq
MIRT1165491	hsa-miR-548aa	CLIP-seq
MIRT1165492	hsa-miR-548ac	CLIP-seq
MIRT1165493	hsa-miR-548d-3p	CLIP-seq
MIRT1165494	hsa-miR-548z	CLIP-seq
MIRT1165495	hsa-miR-557	CLIP-seq
MIRT1165496	hsa-miR-613	CLIP-seq
MIRT1165497	hsa-miR-642b	CLIP-seq
MIRT1165498	hsa-miR-670	CLIP-seq
MIRT1165499	hsa-miR-770-5p	CLIP-seq
MIRT1165500	hsa-miR-935	CLIP-seq
MIRT1165501	hsa-miR-96	CLIP-seq
MIRT1165442	hsa-miR-1271	CLIP-seq
MIRT2047846	hsa-miR-1280	CLIP-seq
MIRT2047847	hsa-miR-1301	CLIP-seq
MIRT1165449	hsa-miR-182	CLIP-seq
MIRT2047848	hsa-miR-198	CLIP-seq
MIRT2047849	hsa-miR-2355-5p	CLIP-seq
MIRT2047850	hsa-miR-2681	CLIP-seq
MIRT2047851	hsa-miR-3125	CLIP-seq
MIRT1165454	hsa-miR-3140-3p	CLIP-seq
MIRT1165455	hsa-miR-3152-3p	CLIP-seq
MIRT2047852	hsa-miR-3200-3p	CLIP-seq
MIRT2047853	hsa-miR-3611	CLIP-seq
MIRT2047854	hsa-miR-3916	CLIP-seq
MIRT2047855	hsa-miR-3944-5p	CLIP-seq
MIRT2047856	hsa-miR-4286	CLIP-seq
MIRT2047857	hsa-miR-4422	CLIP-seq
MIRT1165472	hsa-miR-450b-5p	CLIP-seq
MIRT2047858	hsa-miR-452	CLIP-seq
MIRT2047859	hsa-miR-455-3p	CLIP-seq
MIRT2047860	hsa-miR-4676-3p	CLIP-seq
MIRT1165477	hsa-miR-4699-3p	CLIP-seq
MIRT2047861	hsa-miR-4724-3p	CLIP-seq
MIRT2047862	hsa-miR-4778-5p	CLIP-seq
MIRT2047863	hsa-miR-4797-3p	CLIP-seq
MIRT2047864	hsa-miR-5047	CLIP-seq
MIRT1165483	hsa-miR-507	CLIP-seq
MIRT1165484	hsa-miR-513c	CLIP-seq
MIRT1165485	hsa-miR-514b-5p	CLIP-seq
MIRT1165486	hsa-miR-518a-5p	CLIP-seq
MIRT2047865	hsa-miR-520a-5p	CLIP-seq
MIRT2047866	hsa-miR-525-5p	CLIP-seq
MIRT1165490	hsa-miR-527	CLIP-seq
MIRT2047867	hsa-miR-544	CLIP-seq
MIRT1165491	hsa-miR-548aa	CLIP-seq
MIRT1165492	hsa-miR-548ac	CLIP-seq
MIRT1165493	hsa-miR-548d-3p	CLIP-seq
MIRT1165494	hsa-miR-548z	CLIP-seq
MIRT1165495	hsa-miR-557	CLIP-seq
MIRT2047868	hsa-miR-578	CLIP-seq
MIRT2047869	hsa-miR-581	CLIP-seq
MIRT1165501	hsa-miR-96	CLIP-seq
MIRT1165440	hsa-miR-103a	CLIP-seq
MIRT1165441	hsa-miR-107	CLIP-seq
MIRT1165446	hsa-miR-15a	CLIP-seq
MIRT1165447	hsa-miR-15b	CLIP-seq
MIRT1165448	hsa-miR-16	CLIP-seq
MIRT1165450	hsa-miR-1827	CLIP-seq
MIRT1165451	hsa-miR-195	CLIP-seq
MIRT1165464	hsa-miR-424	CLIP-seq
MIRT2276637	hsa-miR-4733-5p	CLIP-seq
MIRT1165482	hsa-miR-497	CLIP-seq
MIRT2276638	hsa-miR-509-3p	CLIP-seq
MIRT2276639	hsa-miR-548m	CLIP-seq
MIRT2276640	hsa-miR-607	CLIP-seq
MIRT2454600	hsa-miR-1276	CLIP-seq
MIRT2276640	hsa-miR-607	CLIP-seq
MIRT2575489	hsa-miR-3117-5p	CLIP-seq
MIRT1165454	hsa-miR-3140-3p	CLIP-seq
MIRT2575490	hsa-miR-338-5p	CLIP-seq
MIRT2575491	hsa-miR-4731-3p	CLIP-seq
MIRT2575492	hsa-miR-4801	CLIP-seq
MIRT2685519	hsa-miR-4729	CLIP-seq
MIRT2276640	hsa-miR-607	CLIP-seq

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001726	Component	Ruffle	NAS	12570871
GO:0003779	Function	Actin binding	IBA
GO:0003779	Function	Actin binding	IEA
GO:0003785	Function	Actin monomer binding	IDA	12570871
GO:0005102	Function	Signaling receptor binding	IPI	12570871
GO:0005515	Function	Protein binding	IPI	15383276, 15688017
GO:0005543	Function	Phospholipid binding	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	12570871
GO:0005856	Component	Cytoskeleton	IEA
GO:0007009	Process	Plasma membrane organization	IEA
GO:0007155	Process	Cell adhesion	NAS	12570871
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	TAS	12570871
GO:0009898	Component	Cytoplasmic side of plasma membrane	IBA
GO:0015629	Component	Actin cytoskeleton	IBA
GO:0015629	Component	Actin cytoskeleton	IDA	12570871
GO:0030035	Process	Microspike assembly	NAS	12570871
GO:0030036	Process	Actin cytoskeleton organization	TAS	12082544
GO:0030139	Component	Endocytic vesicle	TAS	12570871
GO:0032233	Process	Positive regulation of actin filament bundle assembly	IBA
GO:0034334	Process	Adherens junction maintenance	IBA
GO:0042802	Function	Identical protein binding	IPI	14752106
GO:0050680	Process	Negative regulation of epithelial cell proliferation	ISS
GO:0061333	Process	Renal tubule morphogenesis	ISS
GO:0071498	Process	Cellular response to fluid shear stress	ISS
GO:0072102	Process	Glomerulus morphogenesis	ISS
GO:0072160	Process	Nephron tubule epithelial cell differentiation	ISS
GO:2001013	Process	Epithelial cell proliferation involved in renal tubule morphogenesis	ISS

MIM	HGNC	e!Ensembl
608486	20443	ENSG00000170873

O43312

Protein name

Protein MTSS 1 (Metastasis suppressor YGL-1) (Metastasis suppressor protein 1) (Missing in metastasis protein)

Protein function

May be related to cancer progression or tumor metastasis in a variety of organ sites, most likely through an interaction with the actin cytoskeleton.

PDB

2D1K

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08397	IMD	16 → 237	IRSp53/MIM homology domain	Family
PF02205	WH2	724 → 750	WH2 motif	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in many tissues, including spleen, thymus, prostate, testis, uterus, colon, and peripheral blood. {ECO:0000269|PubMed:12082544}.

Sequence

MEAVIEKECSALGGLFQTIISDMKGSYPVWEDFINKAGKLQSQLRTTVVAAAAFLDAFQK
VADMATNTRGGTREIGSALTRMCMRHRSIEAKLRQFSSALIDCLINPLQEQMEEWKKVAN
QLDKDHAKEYKKARQEIKKKSSDTLKLQKKAKKGRGDIQPQLDSALQDVNDKYLLLEETE
KQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISEDLKSLTMDPHKLPSSS
EQVILDLKGSDYSWSYQTPPSSPSTTMSRKSSVCSSLNSVNSSDSRSSGSHSHSPSSHYR
YRSSNLAQQAPVRLSSVSSHDSGFISQDAFQSKSPSPMPPEAPNQLSNGFSHYSLSSESH
VGPTGAGLFPHCLPASRLLPRVTSVHLPDYAHYYTIGPGMFPSSQIPSWKDWAKPGPYDQ
PLVNTLQRRKEKREPDPNGGGPTTASGPPAAAEEAQRPRSMTVSAATRPGEEMEACEELA
LALSRGLQLDTQRSSRDSLQCSSGYSTQTTTPCCSEDTIPSQVSDYDYFSVSGDQEADQQ
EFDKSSTIPRNSDISQSYRRMFQAKRPASTAGLPTTLGPAMVTPGVATIRRTPSTKPSVR
RGTIGAGPIPIKTPVIPVKTPTVPDLPGVLPAPPDGPEERGEHSPESPSVGEGPQGVTSM
PSSMWSGQASVNPPLPGPKPSIPEEHRQAIPESEAEDQEREPPSATVSPGQIPESDPADL
SPRDTPQGEDMLNAIRRGVKLKKTTTNDRSAPRFS

Sequence length

755

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ARTHRITIS, JUVENILE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRRITABLE BOWEL SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL ARTERIAL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (86)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	25996952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29218652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	29928423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	17925019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	27988423		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28146435, 29175021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	26829059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	26829059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	26829059	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	12082544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	15488640, 28739745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19328678, 22322863, 25783158, 29497041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21103787, 21344236, 39519115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24318128	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	16367923, 20712855	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17453818, 26119942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22681717	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	15488640, 28739745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	28739745	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	25625275	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	21196400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22790015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	17925019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	23852458	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30858428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	26705104	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23017832, 24343340, 28068324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23017832	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	29221444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	29928423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	21696600	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	21696600	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	27988423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	27988423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	31545491, 32729377	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	31554410	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	16367923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	23446420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	28739745	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	25996952	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	25996952	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	25996952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	BEFREE	30224667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17442377, 21909138, 22681717, 27230279, 29221140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	17442377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	25625275	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21696600	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23852458, 26198729, 32052679	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	22081072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19328678, 22322863, 25783158, 29497041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	21696600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	22790015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28146435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23383207, 23917490, 24318128, 31541465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	16367923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	20712855, 22081072, 30246429, 31303767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	15488640, 28739745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19328678, 20712855, 21196400, 21696600, 22081072, 24318128, 25996952, 26119942, 26829059, 28068324, 28159994, 29221140, 30858428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	26119942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	17925019		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	24632752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	30250603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	26621336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	24027017	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17442377, 20712855, 21696600, 21909138, 22081072, 22105368, 22790015, 25996952, 26119942, 26621336, 27164937, 27230279, 28146435, 28739745, 29175021, 30246429, 31303767, 31541465 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27634022, 30229825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	22790015		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	22790015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24961659, 35768865	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28146435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	29175021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	26198729	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	32929338	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	22081072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23383207, 23917490, 27164937, 31541465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	21696600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	30949866	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	20712855, 30246429, 31303767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	16367923		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	16367923, 20712855, 33686422	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	32052679	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

MTSS1 (MTSS I-BAR domain containing 1)