Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9787
Gene name	DLG associated protein 5
Gene symbol	DLGAP5
Synonyms (NCBI Gene)	DLG7HURP
Chromosome	14
Chromosome location	14q22.3

123

Show/Hide all (123)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024792	hsa-miR-215-5p	Microarray	19074876
MIRT026832	hsa-miR-192-5p	Microarray	19074876
MIRT042751	hsa-miR-339-5p	CLASH	23622248
MIRT527550	hsa-miR-7844-5p	PAR-CLIP	21572407
MIRT527549	hsa-miR-3133	PAR-CLIP	21572407
MIRT527548	hsa-miR-186-5p	PAR-CLIP	21572407
MIRT527547	hsa-miR-302a-3p	PAR-CLIP	21572407
MIRT527546	hsa-miR-302b-3p	PAR-CLIP	21572407
MIRT527545	hsa-miR-302c-3p	PAR-CLIP	21572407
MIRT527544	hsa-miR-302d-3p	PAR-CLIP	21572407
MIRT527543	hsa-miR-302e	PAR-CLIP	21572407
MIRT527542	hsa-miR-372-3p	PAR-CLIP	21572407
MIRT527541	hsa-miR-373-3p	PAR-CLIP	21572407
MIRT527540	hsa-miR-520a-3p	PAR-CLIP	21572407
MIRT527539	hsa-miR-520b	PAR-CLIP	21572407
MIRT527538	hsa-miR-520c-3p	PAR-CLIP	21572407
MIRT527537	hsa-miR-520d-3p	PAR-CLIP	21572407
MIRT527536	hsa-miR-520e	PAR-CLIP	21572407
MIRT527535	hsa-miR-33a-3p	PAR-CLIP	21572407
MIRT527534	hsa-miR-374c-3p	PAR-CLIP	21572407
MIRT527533	hsa-miR-4744	PAR-CLIP	21572407
MIRT527550	hsa-miR-7844-5p	PAR-CLIP	22012620
MIRT527549	hsa-miR-3133	PAR-CLIP	22012620
MIRT527548	hsa-miR-186-5p	PAR-CLIP	22012620
MIRT527547	hsa-miR-302a-3p	PAR-CLIP	22012620
MIRT527546	hsa-miR-302b-3p	PAR-CLIP	22012620
MIRT527545	hsa-miR-302c-3p	PAR-CLIP	22012620
MIRT527544	hsa-miR-302d-3p	PAR-CLIP	22012620
MIRT527543	hsa-miR-302e	PAR-CLIP	22012620
MIRT527542	hsa-miR-372-3p	PAR-CLIP	22012620
MIRT527541	hsa-miR-373-3p	PAR-CLIP	22012620
MIRT527540	hsa-miR-520a-3p	PAR-CLIP	22012620
MIRT527539	hsa-miR-520b	PAR-CLIP	22012620
MIRT527538	hsa-miR-520c-3p	PAR-CLIP	22012620
MIRT527537	hsa-miR-520d-3p	PAR-CLIP	22012620
MIRT527536	hsa-miR-520e	PAR-CLIP	22012620
MIRT527535	hsa-miR-33a-3p	PAR-CLIP	22012620
MIRT527534	hsa-miR-374c-3p	PAR-CLIP	22012620
MIRT527533	hsa-miR-4744	PAR-CLIP	22012620
MIRT527550	hsa-miR-7844-5p	PAR-CLIP	21572407
MIRT527549	hsa-miR-3133	PAR-CLIP	21572407
MIRT527548	hsa-miR-186-5p	PAR-CLIP	21572407
MIRT527547	hsa-miR-302a-3p	PAR-CLIP	21572407
MIRT527546	hsa-miR-302b-3p	PAR-CLIP	21572407
MIRT527545	hsa-miR-302c-3p	PAR-CLIP	21572407
MIRT527544	hsa-miR-302d-3p	PAR-CLIP	21572407
MIRT527543	hsa-miR-302e	PAR-CLIP	21572407
MIRT527542	hsa-miR-372-3p	PAR-CLIP	21572407
MIRT527541	hsa-miR-373-3p	PAR-CLIP	21572407
MIRT527540	hsa-miR-520a-3p	PAR-CLIP	21572407
MIRT527539	hsa-miR-520b	PAR-CLIP	21572407
MIRT527538	hsa-miR-520c-3p	PAR-CLIP	21572407
MIRT527537	hsa-miR-520d-3p	PAR-CLIP	21572407
MIRT527536	hsa-miR-520e	PAR-CLIP	21572407
MIRT527535	hsa-miR-33a-3p	PAR-CLIP	21572407
MIRT527534	hsa-miR-374c-3p	PAR-CLIP	21572407
MIRT527533	hsa-miR-4744	PAR-CLIP	21572407
MIRT527550	hsa-miR-7844-5p	PAR-CLIP	22012620
MIRT527549	hsa-miR-3133	PAR-CLIP	22012620
MIRT527548	hsa-miR-186-5p	PAR-CLIP	22012620
MIRT527547	hsa-miR-302a-3p	PAR-CLIP	22012620
MIRT527546	hsa-miR-302b-3p	PAR-CLIP	22012620
MIRT527545	hsa-miR-302c-3p	PAR-CLIP	22012620
MIRT527544	hsa-miR-302d-3p	PAR-CLIP	22012620
MIRT527543	hsa-miR-302e	PAR-CLIP	22012620
MIRT527542	hsa-miR-372-3p	PAR-CLIP	22012620
MIRT527541	hsa-miR-373-3p	PAR-CLIP	22012620
MIRT527540	hsa-miR-520a-3p	PAR-CLIP	22012620
MIRT527539	hsa-miR-520b	PAR-CLIP	22012620
MIRT527538	hsa-miR-520c-3p	PAR-CLIP	22012620
MIRT527537	hsa-miR-520d-3p	PAR-CLIP	22012620
MIRT527536	hsa-miR-520e	PAR-CLIP	22012620
MIRT527535	hsa-miR-33a-3p	PAR-CLIP	22012620
MIRT527534	hsa-miR-374c-3p	PAR-CLIP	22012620
MIRT527533	hsa-miR-4744	PAR-CLIP	22012620
MIRT756189	hsa-miR-409-5p	Luciferase reporter assayWestern blottingqRT-PCR	35765271
MIRT938730	hsa-miR-1252	CLIP-seq
MIRT938731	hsa-miR-1290	CLIP-seq
MIRT938732	hsa-miR-204	CLIP-seq
MIRT938733	hsa-miR-211	CLIP-seq
MIRT938734	hsa-miR-3167	CLIP-seq
MIRT938735	hsa-miR-3647-3p	CLIP-seq
MIRT938736	hsa-miR-4286	CLIP-seq
MIRT938737	hsa-miR-4517	CLIP-seq
MIRT938738	hsa-miR-4719	CLIP-seq
MIRT938739	hsa-miR-4755-5p	CLIP-seq
MIRT938740	hsa-miR-4778-5p	CLIP-seq
MIRT938741	hsa-miR-4780	CLIP-seq
MIRT938742	hsa-miR-515-5p	CLIP-seq
MIRT938743	hsa-miR-539	CLIP-seq
MIRT938744	hsa-miR-580	CLIP-seq
MIRT938745	hsa-miR-623	CLIP-seq
MIRT938746	hsa-miR-653	CLIP-seq
MIRT938747	hsa-miR-876-5p	CLIP-seq
MIRT1977726	hsa-miR-4282	CLIP-seq
MIRT938738	hsa-miR-4719	CLIP-seq
MIRT1977727	hsa-miR-513a-3p	CLIP-seq
MIRT938742	hsa-miR-515-5p	CLIP-seq
MIRT938732	hsa-miR-204	CLIP-seq
MIRT938733	hsa-miR-211	CLIP-seq
MIRT938736	hsa-miR-4286	CLIP-seq
MIRT938739	hsa-miR-4755-5p	CLIP-seq
MIRT938741	hsa-miR-4780	CLIP-seq
MIRT938744	hsa-miR-580	CLIP-seq
MIRT938745	hsa-miR-623	CLIP-seq
MIRT938732	hsa-miR-204	CLIP-seq
MIRT938733	hsa-miR-211	CLIP-seq
MIRT2516903	hsa-miR-410	CLIP-seq
MIRT938736	hsa-miR-4286	CLIP-seq
MIRT2516904	hsa-miR-4521	CLIP-seq
MIRT938739	hsa-miR-4755-5p	CLIP-seq
MIRT938741	hsa-miR-4780	CLIP-seq
MIRT938744	hsa-miR-580	CLIP-seq
MIRT938745	hsa-miR-623	CLIP-seq
MIRT938732	hsa-miR-204	CLIP-seq
MIRT938733	hsa-miR-211	CLIP-seq
MIRT2516903	hsa-miR-410	CLIP-seq
MIRT938736	hsa-miR-4286	CLIP-seq
MIRT2516904	hsa-miR-4521	CLIP-seq
MIRT938739	hsa-miR-4755-5p	CLIP-seq
MIRT938741	hsa-miR-4780	CLIP-seq
MIRT938744	hsa-miR-580	CLIP-seq
MIRT938745	hsa-miR-623	CLIP-seq

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	15145941, 15987997, 25416956, 37219487
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	12527899
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0007052	Process	Mitotic spindle organization	IBA
GO:0007059	Process	Chromosome segregation	IBA
GO:0007079	Process	Mitotic chromosome movement towards spindle pole	NAS	12527899
GO:0007346	Process	Regulation of mitotic cell cycle	IBA
GO:0008017	Function	Microtubule binding	IBA
GO:0023052	Process	Signaling	IEA
GO:0031616	Component	Spindle pole centrosome	IBA
GO:0031616	Component	Spindle pole centrosome	IDA	12527899
GO:0045842	Process	Positive regulation of mitotic metaphase/anaphase transition	NAS	12527899
GO:0051382	Process	Kinetochore assembly	IBA
GO:0051642	Process	Centrosome localization	IBA
GO:0072686	Component	Mitotic spindle	IDA

MIM	HGNC	e!Ensembl
617859	16864	ENSG00000126787

Q15398

Protein name

Disks large-associated protein 5 (DAP-5) (Discs large homolog 7) (Disks large-associated protein DLG7) (Hepatoma up-regulated protein) (HURP)

Protein function

Potential cell cycle regulator that may play a role in carcinogenesis of cancer cells. Mitotic phosphoprotein regulated by the ubiquitin-proteasome pathway. Key regulator of adherens junction integrity and differentiation that may be involved in

PDB

7ZX4 , 8X9P , 9DUQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03359	GKAP	318 → 602	Guanylate-kinase-associated protein (GKAP) protein	Family

Tissue specificity

TISSUE SPECIFICITY: Abundantly expressed in fetal liver. Expressed at lower levels in bone marrow, testis, colon, and placenta. {ECO:0000269|PubMed:12527899}.

Sequence

MSSSHFASRHRKDISTEMIRTKIAHRKSLSQKENRHKEYERNRHFGLKDVNIPTLEGRIL
VELDETSQGLVPEKTNVKPRAMKTILGDQRKQMLQKYKEEKQLQKLKEQREKAKRGIFKV
GRYRPDMPCFLLSNQNAVKAEPKKAIPSSVRITRSKAKDQMEQTKIDNESDVRAIRPGPR
QTSEKKVSDKEKKVVQPVMPTSLRMTRSATQAAKQVPRTVSSTTARKPVTRAANENEPEG
KVPSKGRPAKNVETKPDKGISCKVDSEENTLNSQTNATSGMNPDGVLSKMENLPEINTAK
IKGKNSFAPKDFMFQPLDGLKTYQVTPMTPRSANAFLTPSYTWTPLKTEVDESQATKEIL
AQKCKTYSTKTIQQDSNKLPCPLGPLTVWHEEHVLNKNEATTKNLNGLPIKEVPSLERNE
GRIAQPHHGVPYFRNILQSETEKLTSHCFEWDRKLELDIPDDAKDLIRTAVGQTRLLMKE
RFKQFEGLVDDCEYKRGIKETTCTDLDGFWDMVSFQIEDVIHKFNNLIKLEESGWQVNNN
MNHNMNKNVFRKKVVSGIASKPKQDDAGRIAARNRLAAIKNAMRERIRQEECAETAVSVI
PKEVDKIVFDAGFFRVESPVKLFSGLSVSSEGPSQRLGTPKSVNKAVSQSRNEMGIPQQT
TSPENAGPQNTKSEHVKKTLFLSIPESRSSIEDAQCPGLPDLIEENHVVNKTDLKVDCLS
SERMSLPLLAGGVADDINTNKKEGISDVVEGMELNSSITSQDVLMSSPEKNTASQNSILE
EGETKISQSELFDNKSLTTECHLLDSPGLNCSNPFTQLERRHQEHARHISFGGNLITFSP
LQPGEF

Sequence length

846

Interactions

View interactions

	Reactome
			NOTCH3 Intracellular Domain Regulates Transcription

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (53)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Azoospermia	Azoospermia	Pubtator	35219767	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	24183881, 24375315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25756514, 30476929, 33499770, 37958803	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34675265	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22363440, 24324629, 35403252	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29484418	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22022601, 24324629, 29484418, 30616080, 33784984, 36120772, 40243557, 40621461	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	24183881, 24375315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28808310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	29483831, 35403252	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36499051	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	29484418	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	36186000	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22363440, 31286215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22363440	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35774271, 36123948	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	32573962	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Contact	Contact dermatitis	Pubtator	33318199	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36186000	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	32443386	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31611967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31611967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33956061	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35676807	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	33160365	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	37481543	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	35634845	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	15340842, 24324629, 29484418, 30616080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28808310, 37910672	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28808310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24349376, 31454442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30365066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	24183881, 24375315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22048964, 30365066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	21157382	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11543626, 12100959, 22363440, 30616080, 31286215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11146231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	23251412	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29484418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	36186000	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22396495, 31729978	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	29483831	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	35370991	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24349376, 31454442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	29233929, 31454442	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	32443297	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	39259097	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30365066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30365066	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	12100959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	27796151	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tumors of Adrenal Cortex	Tumors Of Adrenal Cortex	LHGDN	19139432		★★★★★ ★☆☆☆☆ Found in Text Mining only

DLGAP5 (DLG associated protein 5)