Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	9784
Gene name	Sorting nexin 17
Gene symbol	SNX17
Synonyms (NCBI Gene)	-
Chromosome	2
Chromosome location	2p23.3
Summary	This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like

162

Show/Hide all (162)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022223	hsa-miR-124-3p	Microarray	18668037
MIRT040825	hsa-miR-18a-3p	CLASH	23622248
MIRT496117	hsa-miR-4500	PAR-CLIP	22291592
MIRT496116	hsa-let-7a-5p	PAR-CLIP	22291592
MIRT496115	hsa-let-7b-5p	PAR-CLIP	22291592
MIRT496114	hsa-let-7c-5p	PAR-CLIP	22291592
MIRT496113	hsa-let-7d-5p	PAR-CLIP	22291592
MIRT496112	hsa-miR-98-5p	PAR-CLIP	22291592
MIRT496111	hsa-let-7e-5p	PAR-CLIP	22291592
MIRT496110	hsa-let-7f-5p	PAR-CLIP	22291592
MIRT496109	hsa-let-7g-5p	PAR-CLIP	22291592
MIRT496108	hsa-miR-4458	PAR-CLIP	22291592
MIRT496107	hsa-let-7i-5p	PAR-CLIP	22291592
MIRT496106	hsa-miR-6873-5p	PAR-CLIP	22291592
MIRT496105	hsa-miR-1910-3p	PAR-CLIP	22291592
MIRT496104	hsa-miR-6511a-5p	PAR-CLIP	22291592
MIRT496103	hsa-miR-6808-5p	PAR-CLIP	22291592
MIRT496102	hsa-miR-6893-5p	PAR-CLIP	22291592
MIRT496101	hsa-miR-940	PAR-CLIP	22291592
MIRT496100	hsa-miR-2682-5p	PAR-CLIP	22291592
MIRT496099	hsa-miR-34b-5p	PAR-CLIP	22291592
MIRT496098	hsa-miR-449c-5p	PAR-CLIP	22291592
MIRT496097	hsa-miR-6750-5p	PAR-CLIP	22291592
MIRT496096	hsa-miR-6822-5p	PAR-CLIP	22291592
MIRT496095	hsa-miR-4257	PAR-CLIP	22291592
MIRT496094	hsa-miR-6806-5p	PAR-CLIP	22291592
MIRT726479	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT726478	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT496117	hsa-miR-4500	PAR-CLIP	22291592
MIRT496116	hsa-let-7a-5p	PAR-CLIP	22291592
MIRT496115	hsa-let-7b-5p	PAR-CLIP	22291592
MIRT496114	hsa-let-7c-5p	PAR-CLIP	22291592
MIRT496113	hsa-let-7d-5p	PAR-CLIP	22291592
MIRT496112	hsa-miR-98-5p	PAR-CLIP	22291592
MIRT496111	hsa-let-7e-5p	PAR-CLIP	22291592
MIRT496110	hsa-let-7f-5p	PAR-CLIP	22291592
MIRT496109	hsa-let-7g-5p	PAR-CLIP	22291592
MIRT496108	hsa-miR-4458	PAR-CLIP	22291592
MIRT496107	hsa-let-7i-5p	PAR-CLIP	22291592
MIRT496106	hsa-miR-6873-5p	PAR-CLIP	22291592
MIRT496105	hsa-miR-1910-3p	PAR-CLIP	22291592
MIRT496104	hsa-miR-6511a-5p	PAR-CLIP	22291592
MIRT496103	hsa-miR-6808-5p	PAR-CLIP	22291592
MIRT496102	hsa-miR-6893-5p	PAR-CLIP	22291592
MIRT496101	hsa-miR-940	PAR-CLIP	22291592
MIRT496100	hsa-miR-2682-5p	PAR-CLIP	22291592
MIRT496099	hsa-miR-34b-5p	PAR-CLIP	22291592
MIRT496098	hsa-miR-449c-5p	PAR-CLIP	22291592
MIRT496097	hsa-miR-6750-5p	PAR-CLIP	22291592
MIRT496096	hsa-miR-6822-5p	PAR-CLIP	22291592
MIRT496095	hsa-miR-4257	PAR-CLIP	22291592
MIRT496094	hsa-miR-6806-5p	PAR-CLIP	22291592
MIRT1377150	hsa-miR-1275	CLIP-seq
MIRT1377151	hsa-miR-1470	CLIP-seq
MIRT1377152	hsa-miR-151-3p	CLIP-seq
MIRT1377153	hsa-miR-1913	CLIP-seq
MIRT1377154	hsa-miR-1915	CLIP-seq
MIRT1377155	hsa-miR-19a	CLIP-seq
MIRT1377156	hsa-miR-19b	CLIP-seq
MIRT1377157	hsa-miR-2110	CLIP-seq
MIRT1377158	hsa-miR-2113	CLIP-seq
MIRT1377159	hsa-miR-3127-3p	CLIP-seq
MIRT1377160	hsa-miR-3194-5p	CLIP-seq
MIRT1377161	hsa-miR-324-3p	CLIP-seq
MIRT1377162	hsa-miR-326	CLIP-seq
MIRT1377163	hsa-miR-330-5p	CLIP-seq
MIRT1377164	hsa-miR-3607-3p	CLIP-seq
MIRT1377165	hsa-miR-3686	CLIP-seq
MIRT1377166	hsa-miR-4269	CLIP-seq
MIRT1377167	hsa-miR-4271	CLIP-seq
MIRT1377168	hsa-miR-4471	CLIP-seq
MIRT1377169	hsa-miR-4525	CLIP-seq
MIRT1377170	hsa-miR-4640-5p	CLIP-seq
MIRT1377171	hsa-miR-4641	CLIP-seq
MIRT1377172	hsa-miR-4652-3p	CLIP-seq
MIRT1377173	hsa-miR-4665-5p	CLIP-seq
MIRT1377174	hsa-miR-4667-5p	CLIP-seq
MIRT1377175	hsa-miR-4690-3p	CLIP-seq
MIRT1377176	hsa-miR-4700-5p	CLIP-seq
MIRT1377177	hsa-miR-4723-5p	CLIP-seq
MIRT1377178	hsa-miR-4725-3p	CLIP-seq
MIRT1377179	hsa-miR-4726-5p	CLIP-seq
MIRT1377180	hsa-miR-4735-5p	CLIP-seq
MIRT1377181	hsa-miR-548m	CLIP-seq
MIRT1377182	hsa-miR-625	CLIP-seq
MIRT1377183	hsa-miR-637	CLIP-seq
MIRT2112203	hsa-miR-1271	CLIP-seq
MIRT2112204	hsa-miR-182	CLIP-seq
MIRT2112205	hsa-miR-196a	CLIP-seq
MIRT2112206	hsa-miR-196b	CLIP-seq
MIRT1377157	hsa-miR-2110	CLIP-seq
MIRT2112207	hsa-miR-3132	CLIP-seq
MIRT2112208	hsa-miR-3154	CLIP-seq
MIRT2112209	hsa-miR-3179	CLIP-seq
MIRT1377162	hsa-miR-326	CLIP-seq
MIRT1377163	hsa-miR-330-5p	CLIP-seq
MIRT2112210	hsa-miR-331-3p	CLIP-seq
MIRT1377164	hsa-miR-3607-3p	CLIP-seq
MIRT2112211	hsa-miR-3616-3p	CLIP-seq
MIRT1377165	hsa-miR-3686	CLIP-seq
MIRT2112212	hsa-miR-3926	CLIP-seq
MIRT2112213	hsa-miR-3927	CLIP-seq
MIRT2112214	hsa-miR-3936	CLIP-seq
MIRT1377167	hsa-miR-4271	CLIP-seq
MIRT2112215	hsa-miR-4436b-3p	CLIP-seq
MIRT2112216	hsa-miR-4451	CLIP-seq
MIRT1377168	hsa-miR-4471	CLIP-seq
MIRT1377170	hsa-miR-4640-5p	CLIP-seq
MIRT2112217	hsa-miR-4642	CLIP-seq
MIRT1377172	hsa-miR-4652-3p	CLIP-seq
MIRT1377174	hsa-miR-4667-5p	CLIP-seq
MIRT1377176	hsa-miR-4700-5p	CLIP-seq
MIRT1377178	hsa-miR-4725-3p	CLIP-seq
MIRT1377179	hsa-miR-4726-5p	CLIP-seq
MIRT1377180	hsa-miR-4735-5p	CLIP-seq
MIRT1377181	hsa-miR-548m	CLIP-seq
MIRT2112218	hsa-miR-548s	CLIP-seq
MIRT1377183	hsa-miR-637	CLIP-seq
MIRT2112219	hsa-miR-96	CLIP-seq
MIRT2112203	hsa-miR-1271	CLIP-seq
MIRT1377150	hsa-miR-1275	CLIP-seq
MIRT1377152	hsa-miR-151-3p	CLIP-seq
MIRT2112204	hsa-miR-182	CLIP-seq
MIRT1377155	hsa-miR-19a	CLIP-seq
MIRT1377156	hsa-miR-19b	CLIP-seq
MIRT1377158	hsa-miR-2113	CLIP-seq
MIRT2112207	hsa-miR-3132	CLIP-seq
MIRT2335468	hsa-miR-3136-3p	CLIP-seq
MIRT2335469	hsa-miR-3166	CLIP-seq
MIRT1377162	hsa-miR-326	CLIP-seq
MIRT2335470	hsa-miR-328	CLIP-seq
MIRT1377163	hsa-miR-330-5p	CLIP-seq
MIRT2112211	hsa-miR-3616-3p	CLIP-seq
MIRT2335471	hsa-miR-3714	CLIP-seq
MIRT2335472	hsa-miR-4267	CLIP-seq
MIRT1377166	hsa-miR-4269	CLIP-seq
MIRT2335473	hsa-miR-4281	CLIP-seq
MIRT2335474	hsa-miR-4326	CLIP-seq
MIRT2335475	hsa-miR-4419a	CLIP-seq
MIRT2112215	hsa-miR-4436b-3p	CLIP-seq
MIRT2112216	hsa-miR-4451	CLIP-seq
MIRT2335476	hsa-miR-4510	CLIP-seq
MIRT2335477	hsa-miR-4514	CLIP-seq
MIRT1377169	hsa-miR-4525	CLIP-seq
MIRT1377170	hsa-miR-4640-5p	CLIP-seq
MIRT1377171	hsa-miR-4641	CLIP-seq
MIRT2112217	hsa-miR-4642	CLIP-seq
MIRT1377173	hsa-miR-4665-5p	CLIP-seq
MIRT1377174	hsa-miR-4667-5p	CLIP-seq
MIRT2335478	hsa-miR-4691-5p	CLIP-seq
MIRT2335479	hsa-miR-4692	CLIP-seq
MIRT1377176	hsa-miR-4700-5p	CLIP-seq
MIRT1377177	hsa-miR-4723-5p	CLIP-seq
MIRT1377179	hsa-miR-4726-5p	CLIP-seq
MIRT1377180	hsa-miR-4735-5p	CLIP-seq
MIRT2335480	hsa-miR-4766-5p	CLIP-seq
MIRT2335481	hsa-miR-584	CLIP-seq
MIRT1377182	hsa-miR-625	CLIP-seq
MIRT1377183	hsa-miR-637	CLIP-seq
MIRT2112219	hsa-miR-96	CLIP-seq
MIRT1377170	hsa-miR-4640-5p	CLIP-seq
MIRT1377179	hsa-miR-4726-5p	CLIP-seq

Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001822	Process	Kidney development	IEA
GO:0003279	Process	Cardiac septum development	IEA
GO:0005102	Function	Signaling receptor binding	NAS	12169628
GO:0005515	Function	Protein binding	IPI	11237770, 16712798, 17474147, 28892079, 32296183, 32814053, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IDA	23382219, 28892079
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IBA
GO:0005769	Component	Early endosome	IDA	12169628
GO:0005769	Component	Early endosome	IEA
GO:0005794	Component	Golgi apparatus	IDA	10942595
GO:0005829	Component	Cytosol	IDA	16712798
GO:0006707	Process	Cholesterol catabolic process	IC	12169628
GO:0006886	Process	Intracellular protein transport	IBA
GO:0006886	Process	Intracellular protein transport	NAS	12169628
GO:0006898	Process	Receptor-mediated endocytosis	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0010008	Component	Endosome membrane	IDA	23382219
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	12169628
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0016197	Process	Endosomal transport	NAS	12169628
GO:0030100	Process	Regulation of endocytosis	NAS	12169628
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IDA	16712798
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032456	Process	Endocytic recycling	IBA
GO:0032456	Process	Endocytic recycling	IMP	28892079
GO:0032991	Component	Protein-containing complex	IDA	23382219
GO:0035091	Function	Phosphatidylinositol binding	IBA
GO:0035091	Function	Phosphatidylinositol binding	IDA	16712798
GO:0035091	Function	Phosphatidylinositol binding	IEA
GO:0035904	Process	Aorta development	IEA
GO:0050750	Function	Low-density lipoprotein particle receptor binding	IDA	12169628
GO:0060976	Process	Coronary vasculature development	IEA

MIM	HGNC	e!Ensembl
605963	14979	ENSG00000115234

Q15036

Protein name

Sorting nexin-17

Protein function

Critical regulator of endosomal recycling of numerous surface proteins, including integrins, signaling receptor and channels (PubMed:15121882, PubMed:15769472, PubMed:39587083). Binds to NPxY sequences in the cytoplasmic tails of target cargos (

PDB

3FOG , 3LUI , 4GXB , 4TKN , 7RM8 , 9AU7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00787	PX	23 → 105	PX domain	Domain
PF18116	SNX17_FERM_C	270 → 384	Sorting Nexin 17 FERM C-terminal domain	Domain

Sequence

MHFSIPETESRSGDSGGSAYVAYNIHVNGVLHCRVRYSQLLGLHEQLRKEYGANVLPAFP
PKKLFSLTPAEVEQRREQLEKYMQAVRQDPLLGSSETFNSFLRRAQQETQQVPTEEVSLE
VLLSNGQKVLVNVLTSDQTEDVLEAVAAKLDLPDDLIGYFSLFLVREKEDGAFSFVRKLQ
EFELPYVSVTSLRSQEYKIVLRKSYWDSAYDDDVMENRVGLNLLYAQTVSDIERGWILVT
KEQHRQLKSLQEKVSKKEFLRLAQTLRHYGYLRFDACVADFPEKDCPVVVSAGNSELSLQ
LRLPGQQLREGSFRVTRMRCWRVTSSVPLPSGSTSSPGRGRGEVRLELAFEYLMSKDRLQ
WVTITSPQAIMMSICLQSMVDELMVKKSGGSIRKMLRRRVGGTLRRSDSQQAVKSPPLLE
SPDATRESMVKLSSKLSAVSLRGIGSPSTDASASDVHGNFAFEGIGDEDL

Sequence length

470

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLADDER CALCULUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINITIS PIGMENTOSA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SNX17-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UROLITHIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arthritis, Gouty	Gouty arthritis	GWASDB_DG	20884846, 23263486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30939909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	40303303	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholecystolithiasis	Pubtator	40428345	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	GWASDB_DG	20884846, 23263486		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	30025651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	31671755	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SNX17 (sorting nexin 17)