RAPGEF5 (Rap guanine nucleotide exchange factor 5)

Gene

• Entrez ID: 9771
• Gene name: Rap guanine nucleotide exchange factor 5
• Gene symbol: RAPGEF5
• Synonyms (NCBI Gene): GFR, MR-GEF, MRGEF, REPAC
• Chromosome: 7
• Chromosome location: 7p15.3
• Summary: Members of the RAS (see HRAS; MIM 190020) subfamily of GTPases function in signal transduction as GTP/GDP-regulated switches that cycle between inactive GDP- and active GTP-bound states. Guanine nucleotide exchange factors (GEFs), such as RAPGEF5, serve a

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1290865	hsa-miR-101	CLIP-seq
MIRT1290866	hsa-miR-103a	CLIP-seq
MIRT1290867	hsa-miR-107	CLIP-seq
MIRT1290868	hsa-miR-1208	CLIP-seq
MIRT1290869	hsa-miR-1270	CLIP-seq
MIRT1290870	hsa-miR-144	CLIP-seq
MIRT1290871	hsa-miR-15a	CLIP-seq
MIRT1290872	hsa-miR-15b	CLIP-seq
MIRT1290873	hsa-miR-16	CLIP-seq
MIRT1290874	hsa-miR-1827	CLIP-seq
MIRT1290875	hsa-miR-195	CLIP-seq
MIRT1290876	hsa-miR-224	CLIP-seq
MIRT1290877	hsa-miR-3170	CLIP-seq
MIRT1290878	hsa-miR-3664-5p	CLIP-seq
MIRT1290879	hsa-miR-374c	CLIP-seq
MIRT1290880	hsa-miR-3929	CLIP-seq
MIRT1290881	hsa-miR-424	CLIP-seq
MIRT1290882	hsa-miR-4254	CLIP-seq
MIRT1290883	hsa-miR-4257	CLIP-seq
MIRT1290884	hsa-miR-4279	CLIP-seq
MIRT1290885	hsa-miR-4292	CLIP-seq
MIRT1290886	hsa-miR-4303	CLIP-seq
MIRT1290887	hsa-miR-4307	CLIP-seq
MIRT1290888	hsa-miR-4308	CLIP-seq
MIRT1290889	hsa-miR-4310	CLIP-seq
MIRT1290890	hsa-miR-4419b	CLIP-seq
MIRT1290891	hsa-miR-4422	CLIP-seq
MIRT1290892	hsa-miR-4468	CLIP-seq
MIRT1290893	hsa-miR-4477b	CLIP-seq
MIRT1290894	hsa-miR-4478	CLIP-seq
MIRT1290895	hsa-miR-4672	CLIP-seq
MIRT1290896	hsa-miR-4683	CLIP-seq
MIRT1290897	hsa-miR-4691-5p	CLIP-seq
MIRT1290898	hsa-miR-4698	CLIP-seq
MIRT1290899	hsa-miR-4714-5p	CLIP-seq
MIRT1290900	hsa-miR-4789-5p	CLIP-seq
MIRT1290901	hsa-miR-497	CLIP-seq
MIRT1290902	hsa-miR-590-3p	CLIP-seq
MIRT1290903	hsa-miR-615-5p	CLIP-seq
MIRT1290904	hsa-miR-620	CLIP-seq
MIRT1290905	hsa-miR-655	CLIP-seq
MIRT2086503	hsa-miR-1271	CLIP-seq
MIRT2086504	hsa-miR-1273g	CLIP-seq
MIRT2086505	hsa-miR-1276	CLIP-seq
MIRT2086506	hsa-miR-1323	CLIP-seq
MIRT2086507	hsa-miR-3148	CLIP-seq
MIRT2086508	hsa-miR-338-3p	CLIP-seq
MIRT2086509	hsa-miR-3607-5p	CLIP-seq
MIRT2086510	hsa-miR-3667-3p	CLIP-seq
MIRT2086511	hsa-miR-3973	CLIP-seq
MIRT2086512	hsa-miR-4530	CLIP-seq
MIRT1290895	hsa-miR-4672	CLIP-seq
MIRT2086513	hsa-miR-4717-3p	CLIP-seq
MIRT2086514	hsa-miR-520g	CLIP-seq
MIRT2086515	hsa-miR-520h	CLIP-seq
MIRT2086516	hsa-miR-548ac	CLIP-seq
MIRT2086517	hsa-miR-548ae	CLIP-seq
MIRT2086518	hsa-miR-548aj	CLIP-seq
MIRT2086519	hsa-miR-548am	CLIP-seq
MIRT2086520	hsa-miR-548d-3p	CLIP-seq
MIRT2086521	hsa-miR-548o	CLIP-seq
MIRT2086522	hsa-miR-548x	CLIP-seq
MIRT2086523	hsa-miR-548z	CLIP-seq
MIRT2086524	hsa-miR-601	CLIP-seq
MIRT2086525	hsa-miR-636	CLIP-seq
MIRT2086526	hsa-miR-96	CLIP-seq
MIRT1290868	hsa-miR-1208	CLIP-seq
MIRT2311579	hsa-miR-1253	CLIP-seq
MIRT2311580	hsa-miR-125a-5p	CLIP-seq
MIRT2311581	hsa-miR-125b	CLIP-seq
MIRT1290874	hsa-miR-1827	CLIP-seq
MIRT2311582	hsa-miR-194	CLIP-seq
MIRT2311583	hsa-miR-196a	CLIP-seq
MIRT2311584	hsa-miR-196b	CLIP-seq
MIRT2311585	hsa-miR-2114	CLIP-seq
MIRT2311586	hsa-miR-218	CLIP-seq
MIRT2311587	hsa-miR-2276	CLIP-seq
MIRT2311588	hsa-miR-3064-5p	CLIP-seq
MIRT2311589	hsa-miR-3119	CLIP-seq
MIRT2311590	hsa-miR-3128	CLIP-seq
MIRT2311591	hsa-miR-3129-3p	CLIP-seq
MIRT2086507	hsa-miR-3148	CLIP-seq
MIRT2311592	hsa-miR-331-5p	CLIP-seq
MIRT2311593	hsa-miR-3529	CLIP-seq
MIRT2086509	hsa-miR-3607-5p	CLIP-seq
MIRT2311594	hsa-miR-3620	CLIP-seq
MIRT2311595	hsa-miR-3622a-3p	CLIP-seq
MIRT2311596	hsa-miR-3622b-3p	CLIP-seq
MIRT1290878	hsa-miR-3664-5p	CLIP-seq
MIRT2311597	hsa-miR-379	CLIP-seq
MIRT2311598	hsa-miR-3927	CLIP-seq
MIRT2086511	hsa-miR-3973	CLIP-seq
MIRT2311599	hsa-miR-4251	CLIP-seq
MIRT1290883	hsa-miR-4257	CLIP-seq
MIRT2311600	hsa-miR-4280	CLIP-seq
MIRT2311601	hsa-miR-4319	CLIP-seq
MIRT2311602	hsa-miR-4324	CLIP-seq
MIRT2311603	hsa-miR-4329	CLIP-seq
MIRT2311604	hsa-miR-4420	CLIP-seq
MIRT2311605	hsa-miR-4470	CLIP-seq
MIRT2311606	hsa-miR-4522	CLIP-seq
MIRT2311607	hsa-miR-4540	CLIP-seq
MIRT2311608	hsa-miR-4670-3p	CLIP-seq
MIRT1290895	hsa-miR-4672	CLIP-seq
MIRT1290897	hsa-miR-4691-5p	CLIP-seq
MIRT2311609	hsa-miR-4693-3p	CLIP-seq
MIRT1290898	hsa-miR-4698	CLIP-seq
MIRT2311610	hsa-miR-4718	CLIP-seq
MIRT2311611	hsa-miR-4732-3p	CLIP-seq
MIRT2311612	hsa-miR-4735-5p	CLIP-seq
MIRT2311613	hsa-miR-4753-3p	CLIP-seq
MIRT1290900	hsa-miR-4789-5p	CLIP-seq
MIRT2311614	hsa-miR-495	CLIP-seq
MIRT2311615	hsa-miR-5096	CLIP-seq
MIRT2311616	hsa-miR-592	CLIP-seq
MIRT2311617	hsa-miR-597	CLIP-seq
MIRT2311618	hsa-miR-604	CLIP-seq
MIRT1290903	hsa-miR-615-5p	CLIP-seq
MIRT2311619	hsa-miR-616	CLIP-seq
MIRT2311620	hsa-miR-626	CLIP-seq
MIRT2311621	hsa-miR-647	CLIP-seq
MIRT2311622	hsa-miR-656	CLIP-seq
MIRT2311623	hsa-miR-670	CLIP-seq
MIRT2311624	hsa-miR-892b	CLIP-seq
MIRT2311620	hsa-miR-626	CLIP-seq
MIRT2457757	hsa-miR-1279	CLIP-seq
MIRT2457758	hsa-miR-4277	CLIP-seq
MIRT2457759	hsa-miR-4699-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IBA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IDA	10486569
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IEA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	TAS	10934204
GO:0005515	Function	Protein binding	IPI	33961781
GO:0005634	Component	Nucleus	IDA	10486569
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0007264	Process	Small GTPase-mediated signal transduction	IEA
GO:0007264	Process	Small GTPase-mediated signal transduction	NAS	10486569
GO:0007265	Process	Ras protein signal transduction	IBA
GO:0007399	Process	Nervous system development	NAS	10486569
GO:0016604	Component	Nuclear body	IDA
GO:0030742	Function	GTP-dependent protein binding	IPI	10934204

Other IDs

• MIM: 609527
• HGNC: 16862
• e!Ensembl: ENSG00000136237

Protein

• UniProt ID: Q92565
• Protein name: Rap guanine nucleotide exchange factor 5 (Guanine nucleotide exchange factor for Rap1) (M-Ras-regulated Rap GEF) (MR-GEF) (Related to Epac) (Repac)
• Protein function: Guanine nucleotide exchange factor (GEF) for RAP1A, RAP2A and MRAS/M-Ras-GTP. Its association with MRAS inhibits Rap1 activation.
• PDB: 1WGY
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00618	RasGEF_N	71 → 176	RasGEF N-terminal motif	Domain
  PF00617	RasGEF	348 → 525	RasGEF domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed with highest levels in brain.
• Sequence:

  MGSSRLRVFDPHLERKDSAAALSDRELPLPTFDVPYFKYIDEEDEDDEWSSRSQSSTEDD
  SVDSLLSDRYVVVSGTPEKILEHLLNDLHLEEVQDKETETLLDDFLLTYTVFMTTDDLCQ
  ALLRHYSAKKYQGKEENSDVPRRKRKVLHLVSQWIALYKDWLPEDEHSKMFLKTIYRNVL
  DDVYEYPILEKELKEFQKILGMHRRHTVDEYSPQKKNKALFHQFSLKENWLQHRGTVTET
  EEIFCHVYITEHSYVSVKAKVSSIAQEILKVVAEKIQYAEEDLALVAITFSGEKHELQPN
  DLVISKSLEASGRIYVYRKDLADTLNPFAENEESQQRSMRILGMNTWDLALELMNFDWSL
  FNSIHEQELIYFTFSRQGSGEHTANLSLLLQRCNEVQLWVATEILLCSQLGKRVQLVKKF
  IKIAAHCKAQRNLNSFFAIVMGLNTASVSRLSQTWEKIPGKFKKLFSELESLTDPSLNHK
  AYRDAFKKMKPPKIPFMPLLLKDVTFIHEGNKTFLDNLVNFEKLHMIADTVRTLRHCRTN
  QFGDLSPKEHQELKSYVNHLYVIDSQQALFELSHRIEPRV

• Sequence length: 580

Pathways

KEGG:

Ras signaling pathway
Rap1 signaling pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Dilated cardiomyopathy 1A	Likely pathogenic	rs2128099721	RCV002259540	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMPHETAMINE OR RELATED ACTING SYMPATHOMIMETIC ABUSE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE-RELATED DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, FAMILIAL IDIOPATHIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MELANOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEAD AND NECK NEOPLASIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEONECROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adult Rickets	Rickets	BEFREE	12854833, 30238432, 7212758		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	30144150, 30797615		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28790143, 31277183		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30002224		★☆☆☆☆ Found in Text Mining only
Atrophy of kidney	Atrophy Of Kidney	BEFREE	29861397		★☆☆☆☆ Found in Text Mining only
Bardet-Biedl Syndrome	Bardet-Biedl Syndrome	BEFREE	29539623		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	20436929		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	20436929		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	29119846		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20569503	Associate	★☆☆☆☆ Found in Text Mining only
Cakut	Congenital anomalies of kidney and urinary tract	BEFREE	30095653		★☆☆☆☆ Found in Text Mining only
Cancer of Urinary Tract	Urinary Tract Cancer	BEFREE	27900942		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	23932088, 28408440, 28507057, 28934189, 30980645, 31130557, 8989728		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29621274		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	28187233, 28777459		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	37705041	Associate	★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	28712998		★☆☆☆☆ Found in Text Mining only
Chronic interstitial nephritis	Interstitial Nephritis	BEFREE	30973671		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 2	Kidney Disease	BEFREE	29761689, 30710156, 30944297		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 3	Kidney Disease	BEFREE	29559377		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	10616844, 17261426, 18467141, 22078058, 28420065, 28681494, 28712855, 29106593, 29392849, 29921223, 30372836, 31272751, 31277183, 31477263, 31577820		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	17261426, 20576824, 26420894, 27927587, 28050863, 28185105, 28287463, 28380035, 28386744, 28406084, 28578426, 28687072, 28838895, 28901886, 28939943, 28953557, 29079468, 29187794, 29396621, 29616601, 29642060, 29644525, 29735307, 29779025, 29921223, 30008129, 30110711, 30132304, 30135309, 30177485, 30293714, 30352554, 30398155, 30509207, 30659519, 30663195, 30710156, 30716739, 30944297, 30955189, 30980645, 31130557, 31257440, 31288761, 31293181, 31311014, 31380323, 31473625, 31510015, 31573641, 31780737		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	27779785, 29392554		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	27900942		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23434627	Associate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	30830657		★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	31163262		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28306749, 28712998		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28586363		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	27814282		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	28498634		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes	Diabetes	BEFREE	18650481, 19470683, 24603156, 27727024, 28218647, 28287463, 28465376, 28681494, 29054846, 30302966, 31123181		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	18650481, 19470683, 24603156, 27727024, 28089458, 28218647, 28287463, 28465376, 28681494, 29054846, 30293714, 30302966, 30308135, 30723243, 31123181, 31451203		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	14569094, 29534864, 30514308, 31123181		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28143897, 28810595, 29153995, 29176961, 30218617, 30282584, 30308135, 31152118, 31561432, 31621107		★☆☆☆☆ Found in Text Mining only
Diabetes-deafness syndrome maternally transmitted (disorder)	Diabetes and Hearing Loss	BEFREE	18581092		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	14569094, 17151334, 18615900, 21573905, 22095236, 23147199, 24603156, 25514595, 26063197, 27452162, 28060893, 28432733, 28739650, 28810595, 29450720, 31123181, 31277183, 31352861		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dyslipidemias	Dyslipidemias	BEFREE	31712386		★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	29047344		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	1457759		★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	BEFREE	21755431		★☆☆☆☆ Found in Text Mining only
Familial Hypophosphatemic Rickets	Hypophosphatemic Rickets	BEFREE	30238432		★☆☆☆☆ Found in Text Mining only
Fanconi Syndrome	Fanconi Syndrome	BEFREE	29214169		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	28753930		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	GWASCAT_DG	30104761		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	28790143		★☆☆☆☆ Found in Text Mining only
Hepatorenal Syndrome	Hepatorenal Syndrome	BEFREE	30996046		★☆☆☆☆ Found in Text Mining only
Hyperchloremia	Hyperchloremia	BEFREE	19016006		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29985535, 30867247		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	28235143		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Primary	Hyperparathyroidism	BEFREE	233692		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Secondary	Hyperparathyroidism	BEFREE	30348109		★☆☆☆☆ Found in Text Mining only
Hyperphosphatemia (disorder)	Hyperphosphatemia	BEFREE	28218647		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	12242465, 19808243, 21566053, 27147460, 27230965, 27838804, 27873227, 28569557, 28681494, 28978800, 29054846, 29483139, 29949013, 30095653, 30238213, 30595343, 30796705, 31293181		★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	30904999		★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	21566053, 21868615, 6855996		★☆☆☆☆ Found in Text Mining only
Hypocalciuric hypercalcemia, familial, type 1	Hypocalciuric Hypercalcemia	BEFREE	233692		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	30771364		★☆☆☆☆ Found in Text Mining only
Hypophosphatemic Rickets, X-Linked Dominant	Hypophosphatemic Rickets	BEFREE	22193235, 30238432		★☆☆☆☆ Found in Text Mining only
Idiopathic Membranous Glomerulonephritis	Membranous Glomerulonephritis	BEFREE	31352863		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	29042456, 29146701, 30406499		★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	30262120, 31542783		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	10616844, 10616846, 15339995, 16336578, 18467141, 20185605, 21868615, 24311711, 28108166, 28298325, 28411971, 28569557, 29045941, 29153995, 29534864, 29903900, 30466100, 31066481, 31494076, 31506289, 6855996		★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	14514737, 22078058, 25724035, 28089458, 28298325, 31292197, 31292198		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28353411, 28756545, 28953557, 28983757, 29299948, 29396621, 29416818, 30523562, 31424314, 31812538		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	10616844, 18467141, 22078058, 28420065, 28681494, 28712855, 29106593, 29392849, 29921223, 30372836, 31272751, 31277183, 31477263, 31577820		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	29621274, 30469477		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	27779785, 29392554		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	16802358		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	25724035, 30222647		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	PSYGENET_DG	20436929		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	GWASCAT_DG	30219690		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of colon	Colonic Neoplasms	BEFREE	27900942		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	28419086		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11251188		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	20436929		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	30704441		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	30128942		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	24481112, 28306749		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29789781, 30027855, 30785065		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	27498110		★☆☆☆☆ Found in Text Mining only
Nephrocalcinosis	Nephrocalcinosis	BEFREE	21849803		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	30262120, 31542783		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	31163262		★☆☆☆☆ Found in Text Mining only
Nodular glomerulosclerosis	Glomerulosclerosis	BEFREE	6400668		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	20436929		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30594245, 31170925, 31621107		★☆☆☆☆ Found in Text Mining only
Osteomalacia	Osteomalacia	BEFREE	12854833, 30238432, 7212758		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	19808243, 30262120		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30785065, 31629934		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	28810595		★☆☆☆☆ Found in Text Mining only
Pierson syndrome	Pierson Syndrome	BEFREE	22228401		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	19443633, 22193235, 28810844, 29789986, 31628117, 8011974		★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	BEFREE	21566053		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	28498634		★☆☆☆☆ Found in Text Mining only
Pseudohypoaldosteronism, Type II	Pseudohypoaldosteronism	BEFREE	19016006		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	20436929		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28586363		★☆☆☆☆ Found in Text Mining only
Renal dysplasia	Renal dysplasia	BEFREE	17267738		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	10616846, 12242465, 14514737, 18581092, 27246625, 29464358, 30338870, 30702631, 31086955		★☆☆☆☆ Found in Text Mining only
Rickets	Rickets	BEFREE	7212758		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20436929		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	29621274		★☆☆☆☆ Found in Text Mining only
Unilateral agenesis of kidney	Renal aplasia	BEFREE	27759735, 30095653		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	20436929		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urolithiasis	Urolithiasis	BEFREE	31542783		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	28286758		★☆☆☆☆ Found in Text Mining only
Vitamin D-Resistant Rickets, X-Linked	Vitamin D-Dependent Rickets	BEFREE	22193235, 30238432, 3379139		★☆☆☆☆ Found in Text Mining only