Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9770
Gene name	Ras association domain family member 2
Gene symbol	RASSF2
Synonyms (NCBI Gene)	CENP-34RASFADIN
Chromosome	20
Chromosome location	20p13
Summary	This gene encodes a protein that contains a Ras association domain. Similar to its cattle and sheep counterparts, this gene is located near the prion gene. Two alternatively spliced transcripts encoding the same isoform have been reported. [provided by Re

226

Show/Hide all (226)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016642	hsa-miR-429	Reporter assay	20005803
MIRT020352	hsa-miR-200a-3p	Reporter assay	20005803
MIRT021074	hsa-miR-200c-3p	Reporter assay	20005803
MIRT021654	hsa-miR-141-3p	Reporter assay	20005803
MIRT022828	hsa-miR-124-3p	Microarray	18668037
MIRT024131	hsa-miR-200b-3p	Reporter assay	20005803
MIRT031279	hsa-miR-19b-3p	Sequencing	20371350
MIRT721937	hsa-miR-8485	HITS-CLIP	19536157
MIRT721936	hsa-miR-6768-5p	HITS-CLIP	19536157
MIRT721935	hsa-miR-3120-5p	HITS-CLIP	19536157
MIRT399569	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT721934	hsa-miR-3191-5p	HITS-CLIP	19536157
MIRT721933	hsa-miR-6888-3p	HITS-CLIP	19536157
MIRT654422	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT654420	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT654421	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT654419	hsa-miR-3612	HITS-CLIP	23824327
MIRT654418	hsa-miR-650	HITS-CLIP	23824327
MIRT654416	hsa-miR-4443	HITS-CLIP	23824327
MIRT654417	hsa-miR-6515-5p	HITS-CLIP	23824327
MIRT154043	hsa-miR-15a-5p	PAR-CLIP	23708386
MIRT154048	hsa-miR-15b-5p	PAR-CLIP	23708386
MIRT154044	hsa-miR-16-5p	PAR-CLIP	23708386
MIRT154051	hsa-miR-195-5p	PAR-CLIP	23708386
MIRT154054	hsa-miR-424-5p	PAR-CLIP	23708386
MIRT154056	hsa-miR-497-5p	PAR-CLIP	23708386
MIRT154073	hsa-miR-6838-5p	PAR-CLIP	23708386
MIRT495037	hsa-miR-455-5p	PAR-CLIP	23708386
MIRT495036	hsa-miR-5589-3p	PAR-CLIP	23708386
MIRT495034	hsa-miR-4480	PAR-CLIP	23708386
MIRT495035	hsa-miR-1227-3p	PAR-CLIP	23708386
MIRT726782	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT031279	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT737391	hsa-miR-1178-3p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)RNA-seqqRT-PCR	32059341
MIRT721937	hsa-miR-8485	HITS-CLIP	19536157
MIRT721936	hsa-miR-6768-5p	HITS-CLIP	19536157
MIRT721935	hsa-miR-3120-5p	HITS-CLIP	19536157
MIRT399569	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT721934	hsa-miR-3191-5p	HITS-CLIP	19536157
MIRT721933	hsa-miR-6888-3p	HITS-CLIP	19536157
MIRT654422	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT654420	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT654421	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT654419	hsa-miR-3612	HITS-CLIP	23824327
MIRT654418	hsa-miR-650	HITS-CLIP	23824327
MIRT654416	hsa-miR-4443	HITS-CLIP	23824327
MIRT654417	hsa-miR-6515-5p	HITS-CLIP	23824327
MIRT154043	hsa-miR-15a-5p	PAR-CLIP	23708386
MIRT154048	hsa-miR-15b-5p	PAR-CLIP	23708386
MIRT154044	hsa-miR-16-5p	PAR-CLIP	23708386
MIRT154051	hsa-miR-195-5p	PAR-CLIP	23708386
MIRT154054	hsa-miR-424-5p	PAR-CLIP	23708386
MIRT154056	hsa-miR-497-5p	PAR-CLIP	23708386
MIRT154073	hsa-miR-6838-5p	PAR-CLIP	23708386
MIRT495037	hsa-miR-455-5p	PAR-CLIP	23708386
MIRT495036	hsa-miR-5589-3p	PAR-CLIP	23708386
MIRT495034	hsa-miR-4480	PAR-CLIP	23708386
MIRT495035	hsa-miR-1227-3p	PAR-CLIP	23708386
MIRT1292690	hsa-miR-1908	CLIP-seq
MIRT1292691	hsa-miR-339-5p	CLIP-seq
MIRT1292692	hsa-miR-3621	CLIP-seq
MIRT1292693	hsa-miR-4267	CLIP-seq
MIRT1292694	hsa-miR-663	CLIP-seq
MIRT1292695	hsa-miR-1224-3p	CLIP-seq
MIRT1292696	hsa-miR-1260	CLIP-seq
MIRT1292697	hsa-miR-1260b	CLIP-seq
MIRT1292698	hsa-miR-128	CLIP-seq
MIRT1292699	hsa-miR-1280	CLIP-seq
MIRT1292700	hsa-miR-1285	CLIP-seq
MIRT1292701	hsa-miR-1291	CLIP-seq
MIRT1292702	hsa-miR-146b-3p	CLIP-seq
MIRT1292703	hsa-miR-2052	CLIP-seq
MIRT1292704	hsa-miR-24	CLIP-seq
MIRT1292705	hsa-miR-3153	CLIP-seq
MIRT1292706	hsa-miR-3163	CLIP-seq
MIRT1292707	hsa-miR-3183	CLIP-seq
MIRT1292708	hsa-miR-3187-5p	CLIP-seq
MIRT1292709	hsa-miR-323-5p	CLIP-seq
MIRT1292691	hsa-miR-339-5p	CLIP-seq
MIRT1292710	hsa-miR-3615	CLIP-seq
MIRT1292711	hsa-miR-3652	CLIP-seq
MIRT1292712	hsa-miR-374a	CLIP-seq
MIRT1292713	hsa-miR-374b	CLIP-seq
MIRT1292714	hsa-miR-3926	CLIP-seq
MIRT1292715	hsa-miR-4261	CLIP-seq
MIRT1292716	hsa-miR-4284	CLIP-seq
MIRT1292717	hsa-miR-4287	CLIP-seq
MIRT1292718	hsa-miR-4426	CLIP-seq
MIRT1292719	hsa-miR-4428	CLIP-seq
MIRT1292720	hsa-miR-4430	CLIP-seq
MIRT1292721	hsa-miR-4433	CLIP-seq
MIRT1292722	hsa-miR-4476	CLIP-seq
MIRT1292723	hsa-miR-4505	CLIP-seq
MIRT1292724	hsa-miR-4533	CLIP-seq
MIRT1292725	hsa-miR-4646-5p	CLIP-seq
MIRT1292726	hsa-miR-4647	CLIP-seq
MIRT1292727	hsa-miR-4649-3p	CLIP-seq
MIRT1292728	hsa-miR-4662b	CLIP-seq
MIRT1292729	hsa-miR-4663	CLIP-seq
MIRT1292730	hsa-miR-4668-5p	CLIP-seq
MIRT1292731	hsa-miR-4685-3p	CLIP-seq
MIRT1292732	hsa-miR-4723-3p	CLIP-seq
MIRT1292733	hsa-miR-4733-5p	CLIP-seq
MIRT1292734	hsa-miR-4753-3p	CLIP-seq
MIRT1292735	hsa-miR-4766-5p	CLIP-seq
MIRT1292736	hsa-miR-4780	CLIP-seq
MIRT1292737	hsa-miR-4793-3p	CLIP-seq
MIRT1292738	hsa-miR-4802-5p	CLIP-seq
MIRT1292739	hsa-miR-488	CLIP-seq
MIRT1292740	hsa-miR-508-5p	CLIP-seq
MIRT1292741	hsa-miR-548aa	CLIP-seq
MIRT1292742	hsa-miR-548an	CLIP-seq
MIRT1292743	hsa-miR-548s	CLIP-seq
MIRT1292744	hsa-miR-612	CLIP-seq
MIRT1292745	hsa-miR-623	CLIP-seq
MIRT1292746	hsa-miR-628-5p	CLIP-seq
MIRT1292747	hsa-miR-647	CLIP-seq
MIRT1292748	hsa-miR-661	CLIP-seq
MIRT1292749	hsa-miR-765	CLIP-seq
MIRT1292750	hsa-miR-766	CLIP-seq
MIRT1292751	hsa-miR-876-3p	CLIP-seq
MIRT1552955	hsa-miR-3689a-3p	CLIP-seq
MIRT1552956	hsa-miR-3689c	CLIP-seq
MIRT1552957	hsa-miR-4728-5p	CLIP-seq
MIRT2086930	hsa-miR-3117-5p	CLIP-seq
MIRT2086931	hsa-miR-3122	CLIP-seq
MIRT2086932	hsa-miR-3135	CLIP-seq
MIRT2086933	hsa-miR-3150b-3p	CLIP-seq
MIRT2086934	hsa-miR-3616-5p	CLIP-seq
MIRT2086935	hsa-miR-3647-5p	CLIP-seq
MIRT1552955	hsa-miR-3689a-3p	CLIP-seq
MIRT1552956	hsa-miR-3689c	CLIP-seq
MIRT2086936	hsa-miR-3913-5p	CLIP-seq
MIRT1292714	hsa-miR-3926	CLIP-seq
MIRT1292718	hsa-miR-4426	CLIP-seq
MIRT1292721	hsa-miR-4433	CLIP-seq
MIRT1292726	hsa-miR-4647	CLIP-seq
MIRT1292728	hsa-miR-4662b	CLIP-seq
MIRT1552957	hsa-miR-4728-5p	CLIP-seq
MIRT1292733	hsa-miR-4733-5p	CLIP-seq
MIRT2086937	hsa-miR-4784	CLIP-seq
MIRT2086938	hsa-miR-499a-5p	CLIP-seq
MIRT2086939	hsa-miR-539	CLIP-seq
MIRT1292743	hsa-miR-548s	CLIP-seq
MIRT2086940	hsa-miR-573	CLIP-seq
MIRT2086941	hsa-miR-513b	CLIP-seq
MIRT2311873	hsa-miR-1237	CLIP-seq
MIRT2311874	hsa-miR-1248	CLIP-seq
MIRT2311875	hsa-miR-1909	CLIP-seq
MIRT2311876	hsa-miR-194	CLIP-seq
MIRT2311877	hsa-miR-2116	CLIP-seq
MIRT2086931	hsa-miR-3122	CLIP-seq
MIRT2311878	hsa-miR-3124-3p	CLIP-seq
MIRT2311879	hsa-miR-3126-5p	CLIP-seq
MIRT2086932	hsa-miR-3135	CLIP-seq
MIRT1292705	hsa-miR-3153	CLIP-seq
MIRT2311880	hsa-miR-3182	CLIP-seq
MIRT1292691	hsa-miR-339-5p	CLIP-seq
MIRT1552955	hsa-miR-3689a-3p	CLIP-seq
MIRT1552956	hsa-miR-3689c	CLIP-seq
MIRT2086936	hsa-miR-3913-5p	CLIP-seq
MIRT2311881	hsa-miR-4299	CLIP-seq
MIRT2311882	hsa-miR-4310	CLIP-seq
MIRT2311883	hsa-miR-4419a	CLIP-seq
MIRT2311884	hsa-miR-4420	CLIP-seq
MIRT1292721	hsa-miR-4433	CLIP-seq
MIRT2311885	hsa-miR-4456	CLIP-seq
MIRT2311886	hsa-miR-4510	CLIP-seq
MIRT1292730	hsa-miR-4668-5p	CLIP-seq
MIRT2311887	hsa-miR-4677-5p	CLIP-seq
MIRT2311888	hsa-miR-4710	CLIP-seq
MIRT1552957	hsa-miR-4728-5p	CLIP-seq
MIRT2311889	hsa-miR-4792	CLIP-seq
MIRT2311890	hsa-miR-495	CLIP-seq
MIRT2086939	hsa-miR-539	CLIP-seq
MIRT2311891	hsa-miR-548q	CLIP-seq
MIRT2311892	hsa-miR-645	CLIP-seq
MIRT1292714	hsa-miR-3926	CLIP-seq
MIRT1292718	hsa-miR-4426	CLIP-seq
MIRT1292721	hsa-miR-4433	CLIP-seq
MIRT1292726	hsa-miR-4647	CLIP-seq
MIRT1292728	hsa-miR-4662b	CLIP-seq
MIRT1292743	hsa-miR-548s	CLIP-seq
MIRT1292747	hsa-miR-647	CLIP-seq
MIRT2393511	hsa-miR-767-3p	CLIP-seq
MIRT1292698	hsa-miR-128	CLIP-seq
MIRT1292700	hsa-miR-1285	CLIP-seq
MIRT1292704	hsa-miR-24	CLIP-seq
MIRT2086931	hsa-miR-3122	CLIP-seq
MIRT2086932	hsa-miR-3135	CLIP-seq
MIRT1292708	hsa-miR-3187-5p	CLIP-seq
MIRT1292711	hsa-miR-3652	CLIP-seq
MIRT2608288	hsa-miR-3664-5p	CLIP-seq
MIRT1552955	hsa-miR-3689a-3p	CLIP-seq
MIRT1552956	hsa-miR-3689c	CLIP-seq
MIRT2608289	hsa-miR-371-5p	CLIP-seq
MIRT2608290	hsa-miR-371b-5p	CLIP-seq
MIRT2086936	hsa-miR-3913-5p	CLIP-seq
MIRT1292714	hsa-miR-3926	CLIP-seq
MIRT1292716	hsa-miR-4284	CLIP-seq
MIRT1292718	hsa-miR-4426	CLIP-seq
MIRT1292720	hsa-miR-4430	CLIP-seq
MIRT1292721	hsa-miR-4433	CLIP-seq
MIRT1292723	hsa-miR-4505	CLIP-seq
MIRT2608291	hsa-miR-4522	CLIP-seq
MIRT1292726	hsa-miR-4647	CLIP-seq
MIRT1292728	hsa-miR-4662b	CLIP-seq
MIRT1552957	hsa-miR-4728-5p	CLIP-seq
MIRT1292733	hsa-miR-4733-5p	CLIP-seq
MIRT1292734	hsa-miR-4753-3p	CLIP-seq
MIRT2608292	hsa-miR-4768-5p	CLIP-seq
MIRT1292743	hsa-miR-548s	CLIP-seq
MIRT1292744	hsa-miR-612	CLIP-seq
MIRT1292747	hsa-miR-647	CLIP-seq
MIRT2086931	hsa-miR-3122	CLIP-seq
MIRT2086932	hsa-miR-3135	CLIP-seq
MIRT2608288	hsa-miR-3664-5p	CLIP-seq
MIRT1552955	hsa-miR-3689a-3p	CLIP-seq
MIRT1552956	hsa-miR-3689c	CLIP-seq
MIRT2608289	hsa-miR-371-5p	CLIP-seq
MIRT2608290	hsa-miR-371b-5p	CLIP-seq
MIRT2086936	hsa-miR-3913-5p	CLIP-seq
MIRT1292721	hsa-miR-4433	CLIP-seq
MIRT2608291	hsa-miR-4522	CLIP-seq
MIRT1552957	hsa-miR-4728-5p	CLIP-seq
MIRT1292733	hsa-miR-4733-5p	CLIP-seq

Show/Hide all (36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000776	Component	Kinetochore	IDA	20813266
GO:0000776	Component	Kinetochore	IEA
GO:0001501	Process	Skeletal system development	IEA
GO:0001503	Process	Ossification	IEA
GO:0004672	Function	Protein kinase activity	IGI	19962960
GO:0005515	Function	Protein binding	IPI	12732644, 19525978, 20562859, 20920251, 23386615, 23455922, 23455924, 24255178, 24366813, 24981860, 25416956, 28514442, 32296183, 32707033, 32814053, 33961781, 35271311
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	19525978
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	19525978
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0007165	Process	Signal transduction	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007249	Process	Canonical NF-kappaB signal transduction	IEA
GO:0031954	Process	Positive regulation of protein autophosphorylation	IDA	19962960
GO:0032991	Component	Protein-containing complex	IDA	19962960
GO:0033137	Process	Negative regulation of peptidyl-serine phosphorylation	IDA	19962960
GO:0043065	Process	Positive regulation of apoptotic process	IDA	19962960
GO:0045667	Process	Regulation of osteoblast differentiation	IEA
GO:0045670	Process	Regulation of osteoclast differentiation	IEA
GO:0045860	Process	Positive regulation of protein kinase activity	IDA	19962960
GO:0046330	Process	Positive regulation of JNK cascade	IBA
GO:0046330	Process	Positive regulation of JNK cascade	IDA	19962960
GO:0046849	Process	Bone remodeling	IEA
GO:0048872	Process	Homeostasis of number of cells	IEA
GO:0050821	Process	Protein stabilization	IMP	19525978
GO:1901222	Process	Regulation of non-canonical NF-kappaB signal transduction	IBA
GO:1901222	Process	Regulation of non-canonical NF-kappaB signal transduction	IEA
GO:1901223	Process	Negative regulation of non-canonical NF-kappaB signal transduction	IEA

MIM	HGNC	e!Ensembl
609492	9883	ENSG00000101265

P50749

Protein name

Ras association domain-containing protein 2

Protein function

Potential tumor suppressor. Acts as a KRAS-specific effector protein. May promote apoptosis and cell cycle arrest. Stabilizes STK3/MST2 by protecting it from proteasomal degradation. {ECO:0000269|PubMed:12732644, ECO:0000269|PubMed:16012945, ECO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00788	RA	176 → 264	Ras association (RalGDS/AF-6) domain	Domain
PF16517	Nore1-SARAH	277 → 316	Novel Ras effector 1 C-terminal SARAH (Sav/Rassf/Hpo) domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed with highest levels in brain, placenta, peripheral blood and lung. Frequently down-regulated in lung tumor cell lines. {ECO:0000269|PubMed:12732644}.

Sequence

MDYSHQTSLVPCGQDKYISKNELLLHLKTYNLYYEGQNLQLRHREEEDEFIVEGLLNISW
GLRRPIRLQMQDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQISEVDAPPEGDQ
MPSSTDSRGLKPLQEDTPQLMRTRSDVGVRRRGNVRTPSDQRRIRRHRFSINGHFYNHKT
SVFTPAYGSVTNVRINSTMTTPQVLKLLLNKFKIENSAEEFALYVVHTSGEKQKLKATDY
PLIARILQGPCEQISKVFLMEKDQVEEVTYDVAQYIKFEMPVLKSFIQKLQEEEDREVKK
LMRKYTVLRLMIRQRLEEIAETPATI

Sequence length

326

Interactions

View interactions

	KEGG
	Hippo signaling pathway - multiple species

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CERVICAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHATIC METASTASIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASOPHARYNGEAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (74)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	26222671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	16012945, 17923875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	25482183	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26284587, 27097811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23542458, 25482183, 26284587	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34180753	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	CTD_human_DG	17013896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19700653, 20920251	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	18161048	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17549418, 17891178, 23542458		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	23542458		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	23542458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	27861356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16012945, 17183069, 22733432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17013898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19700653	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29503662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29503662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	34560403	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	25298284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	26482475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	26482475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	23887284, 24005033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	20920251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	19700653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	19700653	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25621889	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	27901488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	35222428	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	30992382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17549418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	24871463	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	24871463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	CTD_human_DG	17013896		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	34155937	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	34180753	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	27901488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26284587, 27097811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	26482475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17549418, 17891178, 23542458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of penis	Penile cancer	BEFREE	23998425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16265349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	20920251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17891178, 30171725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	23542458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	17891178, 25482183, 26284587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17891178		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	22113481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	22113481	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal Neoplasms	CTD_human_DG	17013896		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	16012945, 16265349, 17549418, 17891178, 19962960, 20368356, 20920251, 22984959, 23542458, 23887284, 25621889, 26284587, 26482475, 27901488, 31565080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	22695170, 22984959	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	17549418, 17891178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	25298284	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	17891178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25298284	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21792082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	20368356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	38493315	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	26662407	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	23887284, 24005033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	18294275, 26222671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	18294275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	26482475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18294275	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	16265349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	16265349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	16265349, 19700653, 34155937	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	20920251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	20920251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	20920251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	20920251	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23542458	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

RASSF2 (Ras association domain family member 2)