Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	977
Gene name	CD151 molecule (Raph blood group)
Gene symbol	CD151
Synonyms (NCBI Gene)	EBS7GP27MER2PETA-3RAPHSFA1TSPAN24
Chromosome	11
Chromosome location	11p15.5
Summary	The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1565118389	->G	Pathogenic	Coding sequence variant, frameshift variant

156

Show/Hide all (156)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022976	hsa-miR-124-3p	Microarray	18668037
MIRT052276	hsa-let-7b-5p	CLASH	23622248
MIRT042936	hsa-miR-324-3p	CLASH	23622248
MIRT053753	hsa-miR-22-3p	Luciferase reporter assayqRT-PCRWestern blot	24495805
MIRT053753	hsa-miR-22-3p	Luciferase reporter assayqRT-PCRWestern blot	24495805
MIRT054136	hsa-miR-152-3p	Luciferase reporter assayqRT-PCRWestern blot	25119599
MIRT054136	hsa-miR-152-3p	Luciferase reporter assayqRT-PCRWestern blot	25119599
MIRT054566	hsa-miR-506-3p	Luciferase reporter assayqRT-PCRWestern blot	23717581
MIRT054566	hsa-miR-506-3p	Luciferase reporter assayqRT-PCRWestern blot	23717581
MIRT022976	hsa-miR-124-3p	FlowLuciferase reporter assayqRT-PCRWestern blot	23816858
MIRT022976	hsa-miR-124-3p	FlowLuciferase reporter assayqRT-PCRWestern blot	23816858
MIRT737177	hsa-miR-199a-3p	Luciferase reporter assayWestern blottingImmunofluorescenceqRT-PCR	32051735
MIRT873683	hsa-miR-1225-5p	CLIP-seq
MIRT873684	hsa-miR-124	CLIP-seq
MIRT873685	hsa-miR-127-5p	CLIP-seq
MIRT873686	hsa-miR-154	CLIP-seq
MIRT873687	hsa-miR-22	CLIP-seq
MIRT873688	hsa-miR-2355-5p	CLIP-seq
MIRT873689	hsa-miR-2467-3p	CLIP-seq
MIRT873690	hsa-miR-3120-3p	CLIP-seq
MIRT873691	hsa-miR-3136-3p	CLIP-seq
MIRT873692	hsa-miR-3170	CLIP-seq
MIRT873693	hsa-miR-3184	CLIP-seq
MIRT873694	hsa-miR-323b-5p	CLIP-seq
MIRT873695	hsa-miR-3622a-3p	CLIP-seq
MIRT873696	hsa-miR-3622b-3p	CLIP-seq
MIRT873697	hsa-miR-3670	CLIP-seq
MIRT873698	hsa-miR-3675-5p	CLIP-seq
MIRT873699	hsa-miR-3921	CLIP-seq
MIRT873700	hsa-miR-423-5p	CLIP-seq
MIRT873701	hsa-miR-4257	CLIP-seq
MIRT873702	hsa-miR-4466	CLIP-seq
MIRT873703	hsa-miR-4519	CLIP-seq
MIRT873704	hsa-miR-4635	CLIP-seq
MIRT873705	hsa-miR-4649-3p	CLIP-seq
MIRT873706	hsa-miR-4653-5p	CLIP-seq
MIRT873707	hsa-miR-4688	CLIP-seq
MIRT873708	hsa-miR-486-3p	CLIP-seq
MIRT873709	hsa-miR-506	CLIP-seq
MIRT873710	hsa-miR-545	CLIP-seq
MIRT873711	hsa-miR-548aa	CLIP-seq
MIRT873712	hsa-miR-548an	CLIP-seq
MIRT873713	hsa-miR-548p	CLIP-seq
MIRT873714	hsa-miR-584	CLIP-seq
MIRT873715	hsa-miR-615-5p	CLIP-seq
MIRT873716	hsa-miR-675	CLIP-seq
MIRT873717	hsa-miR-933	CLIP-seq
MIRT873718	hsa-miR-103a	CLIP-seq
MIRT873719	hsa-miR-107	CLIP-seq
MIRT873720	hsa-miR-1244	CLIP-seq
MIRT873721	hsa-miR-1262	CLIP-seq
MIRT873722	hsa-miR-15a	CLIP-seq
MIRT873723	hsa-miR-15b	CLIP-seq
MIRT873724	hsa-miR-16	CLIP-seq
MIRT873725	hsa-miR-195	CLIP-seq
MIRT873726	hsa-miR-3922-5p	CLIP-seq
MIRT873727	hsa-miR-3944-5p	CLIP-seq
MIRT873728	hsa-miR-424	CLIP-seq
MIRT873729	hsa-miR-4259	CLIP-seq
MIRT873730	hsa-miR-4701-3p	CLIP-seq
MIRT873731	hsa-miR-4703-3p	CLIP-seq
MIRT873732	hsa-miR-4708-3p	CLIP-seq
MIRT873733	hsa-miR-4715-5p	CLIP-seq
MIRT873734	hsa-miR-497	CLIP-seq
MIRT873720	hsa-miR-1244	CLIP-seq
MIRT1546251	hsa-miR-199b-3p	CLIP-seq
MIRT873689	hsa-miR-2467-3p	CLIP-seq
MIRT1546252	hsa-miR-3129-5p	CLIP-seq
MIRT1546253	hsa-miR-4797-3p	CLIP-seq
MIRT1546254	hsa-miR-936	CLIP-seq
MIRT873683	hsa-miR-1225-5p	CLIP-seq
MIRT873720	hsa-miR-1244	CLIP-seq
MIRT1959166	hsa-miR-1256	CLIP-seq
MIRT1959167	hsa-miR-128	CLIP-seq
MIRT1959168	hsa-miR-148a	CLIP-seq
MIRT1959169	hsa-miR-148b	CLIP-seq
MIRT1959170	hsa-miR-152	CLIP-seq
MIRT873686	hsa-miR-154	CLIP-seq
MIRT1959171	hsa-miR-1913	CLIP-seq
MIRT1546251	hsa-miR-199b-3p	CLIP-seq
MIRT873688	hsa-miR-2355-5p	CLIP-seq
MIRT873689	hsa-miR-2467-3p	CLIP-seq
MIRT873690	hsa-miR-3120-3p	CLIP-seq
MIRT1546252	hsa-miR-3129-5p	CLIP-seq
MIRT1959172	hsa-miR-3173-5p	CLIP-seq
MIRT1959173	hsa-miR-331-3p	CLIP-seq
MIRT1959174	hsa-miR-34a	CLIP-seq
MIRT1959175	hsa-miR-34c-5p	CLIP-seq
MIRT1959176	hsa-miR-3545-5p	CLIP-seq
MIRT873701	hsa-miR-4257	CLIP-seq
MIRT1959177	hsa-miR-4270	CLIP-seq
MIRT1959178	hsa-miR-4436b-3p	CLIP-seq
MIRT1959179	hsa-miR-4441	CLIP-seq
MIRT1959180	hsa-miR-4455	CLIP-seq
MIRT1959181	hsa-miR-449a	CLIP-seq
MIRT1959182	hsa-miR-449b	CLIP-seq
MIRT873703	hsa-miR-4519	CLIP-seq
MIRT1546253	hsa-miR-4797-3p	CLIP-seq
MIRT1959183	hsa-miR-510	CLIP-seq
MIRT1959184	hsa-miR-512-5p	CLIP-seq
MIRT873714	hsa-miR-584	CLIP-seq
MIRT1959185	hsa-miR-609	CLIP-seq
MIRT873717	hsa-miR-933	CLIP-seq
MIRT1546254	hsa-miR-936	CLIP-seq
MIRT873720	hsa-miR-1244	CLIP-seq
MIRT1959166	hsa-miR-1256	CLIP-seq
MIRT1959167	hsa-miR-128	CLIP-seq
MIRT2196119	hsa-miR-1291	CLIP-seq
MIRT2196120	hsa-miR-134	CLIP-seq
MIRT1959168	hsa-miR-148a	CLIP-seq
MIRT1959169	hsa-miR-148b	CLIP-seq
MIRT1959170	hsa-miR-152	CLIP-seq
MIRT1959171	hsa-miR-1913	CLIP-seq
MIRT1546251	hsa-miR-199b-3p	CLIP-seq
MIRT873689	hsa-miR-2467-3p	CLIP-seq
MIRT2196121	hsa-miR-3118	CLIP-seq
MIRT873690	hsa-miR-3120-3p	CLIP-seq
MIRT1546252	hsa-miR-3129-5p	CLIP-seq
MIRT1959172	hsa-miR-3173-5p	CLIP-seq
MIRT1959173	hsa-miR-331-3p	CLIP-seq
MIRT1959174	hsa-miR-34a	CLIP-seq
MIRT1959175	hsa-miR-34c-5p	CLIP-seq
MIRT1959176	hsa-miR-3545-5p	CLIP-seq
MIRT1959177	hsa-miR-4270	CLIP-seq
MIRT1959178	hsa-miR-4436b-3p	CLIP-seq
MIRT1959179	hsa-miR-4441	CLIP-seq
MIRT2196122	hsa-miR-4476	CLIP-seq
MIRT2196123	hsa-miR-4493	CLIP-seq
MIRT1959181	hsa-miR-449a	CLIP-seq
MIRT1959182	hsa-miR-449b	CLIP-seq
MIRT873703	hsa-miR-4519	CLIP-seq
MIRT1546253	hsa-miR-4797-3p	CLIP-seq
MIRT1959183	hsa-miR-510	CLIP-seq
MIRT1959184	hsa-miR-512-5p	CLIP-seq
MIRT873711	hsa-miR-548aa	CLIP-seq
MIRT1546254	hsa-miR-936	CLIP-seq
MIRT873720	hsa-miR-1244	CLIP-seq
MIRT1959166	hsa-miR-1256	CLIP-seq
MIRT2196119	hsa-miR-1291	CLIP-seq
MIRT1959171	hsa-miR-1913	CLIP-seq
MIRT1546251	hsa-miR-199b-3p	CLIP-seq
MIRT873689	hsa-miR-2467-3p	CLIP-seq
MIRT1546252	hsa-miR-3129-5p	CLIP-seq
MIRT1959172	hsa-miR-3173-5p	CLIP-seq
MIRT1959176	hsa-miR-3545-5p	CLIP-seq
MIRT873729	hsa-miR-4259	CLIP-seq
MIRT873731	hsa-miR-4703-3p	CLIP-seq
MIRT873733	hsa-miR-4715-5p	CLIP-seq
MIRT1546253	hsa-miR-4797-3p	CLIP-seq
MIRT1959183	hsa-miR-510	CLIP-seq
MIRT1959184	hsa-miR-512-5p	CLIP-seq
MIRT1546254	hsa-miR-936	CLIP-seq
MIRT2499222	hsa-miR-3127-3p	CLIP-seq
MIRT2499223	hsa-miR-4256	CLIP-seq
MIRT2499222	hsa-miR-3127-3p	CLIP-seq
MIRT2499223	hsa-miR-4256	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
SP1	Activation	20149781

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005178	Function	Integrin binding	IDA	17716972, 27993971
GO:0005178	Function	Integrin binding	IEA
GO:0005178	Function	Integrin binding	IPI	24220332
GO:0005515	Function	Protein binding	IPI	10811835, 14557253, 14676841, 25416956, 25910212, 29892012, 32296183, 33961781, 35271311
GO:0005604	Component	Basement membrane	IDA	23302890
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	9602068
GO:0005886	Component	Plasma membrane	TAS	8627808
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007155	Process	Cell adhesion	NAS	9602068
GO:0009986	Component	Cell surface	IDA	17716972
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	8627808
GO:0016477	Process	Cell migration	IBA
GO:0016477	Process	Cell migration	IEA
GO:0030335	Process	Positive regulation of cell migration	IDA	17716972
GO:0030335	Process	Positive regulation of cell migration	IMP	17716972
GO:0042098	Process	T cell proliferation	IEA
GO:0044319	Process	Wound healing, spreading of cells	IDA	17716972
GO:0044319	Process	Wound healing, spreading of cells	IMP	17716972
GO:0045807	Process	Positive regulation of endocytosis	IDA	17716972
GO:0045807	Process	Positive regulation of endocytosis	IMP	17716972

MIM	HGNC	e!Ensembl
602243	1630	ENSG00000177697

P48509

Protein name

CD151 antigen (GP27) (Membrane glycoprotein SFA-1) (Platelet-endothelial tetraspan antigen 3) (PETA-3) (Tetraspanin-24) (Tspan-24) (CD antigen CD151)

Protein function

Structural component of specialized membrane microdomains known as tetraspanin-enriched microdomains (TERMs), which act as platforms for receptor clustering and signaling. Plays a role in various cellular and molecular mechanism through its asso

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00335	Tetraspanin	16 → 247	Tetraspanin family	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in a variety of tissues including vascular endothelium and epidermis. Expressed on erythroid cells, with a higher level of expression in erythroid precursors than on mature erythrocytes (PubMed:15265795). Acts as a sensitive

Sequence

MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLAT
AYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYAYYQQLNT
ELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVV
PDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIF
TCCLYRSLKLEHY

Sequence length

253

Interactions

View interactions

	Reactome
			Assembly of collagen fibrils and other multimeric structures Type I hemidesmosome assembly

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Epidermolysis bullosa simplex 7, with nephropathy and deafness	Pathogenic; Likely pathogenic	rs1565118389, rs1846753757, rs1846841530	RCV000007805 RCV003222286 RCV003222287	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CD151-related disorder	Conflicting classifications of pathogenicity; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPIDERMOLYSIS BULLOSA SIMPLEX	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROPATHY WITH PRETIBIAL EPIDERMOLYSIS BULLOSA AND DEAFNESS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROTIC SYNDROME, DEAFNESS, PRETIBIAL EPIDERMOLYSIS BULLOSA SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROTIC SYNDROME-EPIDERMOLYSIS BULLOSA-SENSORINEURAL DEAFNESS SYNDROME	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RAPH BLOOD GROUP SYSTEM	Likely benign; Benign; Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (107)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	27577713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	27577713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	25351816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	28473332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	9743375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic Ependymoma	Anaplastic Ependymoma	BEFREE	27401149		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	20927591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29138006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	27233153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	20543560	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	15265795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18451146, 22952421, 22986527, 23816858, 25012362, 26003442, 27888619, 30257985, 30468476, 30639369, 31004251, 31668880, 31783316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21505452, 22294188, 22791584, 23717581, 23816858, 26418423, 30468476	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	36613908	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21961047, 30794666, 37960718	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28473332	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	26464707	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	26418423	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	20118909	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11751509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	29045505	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	21505452	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35955933	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21193415, 27107458	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28273451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	21505452	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	28473332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	20715158	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	22201679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear Cell Sarcoma of Soft Tissue	Sarcoma	BEFREE	31186687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	12838318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12838318	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34638669	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29568359, 29843367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	24201754	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystrophia unguium	Nail dystrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	21505452	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	27401149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermolysis bullosa pretibial	Junctional epidermolysis bullosa	Pubtator	15265795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermolysis bullosa, pretibial	Epidermolysis Bullosa	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28473332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	16204036, 22926763, 26377974, 26992919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26992919	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	16204036, 22926763, 26377974, 26992919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22495828, 22926763, 26992919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26992919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	37974210	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	27444451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	15265795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	22592804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	22201679, 29138120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	15265795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	22201679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	7632941	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	9743375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19065669, 21320503, 21961047, 27270320, 27599545, 28473332, 28524360, 29391901, 30132868, 31772652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	19065669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	28473332	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	25033048	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	17083624	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20715158	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	30468476	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	27444451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18451146, 22952421, 23816858, 25012362, 26003442, 27888619, 30257985, 30468476, 30639369, 31004251, 31668880, 31783316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	20149781, 28473332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11751509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28273451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21042756, 23131993, 24174171, 24220242, 28291843, 29575602, 29891991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23533596, 25119599, 28258379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11751509, 16200075, 19330835, 21428937, 22926763, 23007325, 24174171, 25351816, 27270320, 27343445, 28276309, 28954890, 30257985, 30778617, 31783316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	12838318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	26136426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12579280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	22952421, 31004251		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	16798740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	16798740, 22843693	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	20118909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	17225869, 19079294, 21240296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11739177, 18328426, 19065669, 19184600, 19330835, 19509057, 20927591, 21193415, 21428937, 21600596, 22495828, 22952421, 23533596, 24220242, 25012362 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	30578155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephropathy with Pretibial Epidermolysis Bullosa and Deafness	Nephropathy with Pretibial Epidermolysis Bullosa and Deafness	ORPHANET_DG	15265795		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephropathy with Pretibial Epidermolysis Bullosa and Deafness	Nephropathy with Pretibial Epidermolysis Bullosa and Deafness	GENOMICS_ENGLAND_DG	15265795, 29138120		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephropathy with Pretibial Epidermolysis Bullosa and Deafness	Nephropathy with Pretibial Epidermolysis Bullosa and Deafness	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephropathy with Pretibial Epidermolysis Bullosa and Deafness	Nephropathy with Pretibial Epidermolysis Bullosa and Deafness	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrotic syndrome-epidermolysis bullosa-sensorineural deafness syndrome	Nephrotic Syndrome-Epidermolysis Bullosa-Sensorineural Deafness Syndrome	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	11751509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	20470422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	26707073, 27556355		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28273451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28273451, 36613908	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	28291843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	20927591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21042756, 23131993, 24174171, 24220242, 28291843, 29891991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22457534, 28291843	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	22592804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29568359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	32586373	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	15930335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	27444451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23533596, 25119599, 28258379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23533596, 25119599	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	22294188, 34265469, 39294214	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	36248887	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CD151 (CD151 molecule (Raph blood group))