Gene Gene information from NCBI Gene database.
Entrez ID 9766
Gene name Sushi domain containing 6
Gene symbol SUSD6
Synonyms (NCBI Gene)
DRAGOKIAA0247
Chromosome 14
Chromosome location 14q24.1
miRNA miRNA information provided by mirtarbase database.
50
miRTarBase ID miRNA Experiments Reference
MIRT138798 hsa-miR-106b-5p HITS-CLIP 22473208
MIRT138792 hsa-miR-20a-5p HITS-CLIP 22473208
MIRT138798 hsa-miR-106b-5p HITS-CLIP 22473208
MIRT138791 hsa-miR-17-5p HITS-CLIP 22473208
MIRT138801 hsa-miR-20b-5p HITS-CLIP 22473208
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0006974 Process DNA damage response IBA
GO:0006974 Process DNA damage response IDA 24652652
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
616761 19956 ENSG00000100647
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q92537
Protein name Sushi domain-containing protein 6 (Drug-activated gene overexpressed protein)
Protein function May play a role in growth-suppressive activity and cell death (PubMed:24652652). May be involved in the production of chemokine molecules in umbilical vein endothelial cells (HUVECs) cultured in THP1 monocyte LPS-induced medium (PubMed:20236627)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00084 Sushi 42 102 Sushi repeat (SCR repeat) Domain
Sequence
MCHGRIAPKSTSVFAVASVGHGVFLPLVILCTLLGDGLASVCPLPPEPENGGYICHPRPC
RDPLTAGSVIEYLCAEGYMLKGDYKYLTCKNGEWKPAMEISC
RLNEDKDTHTSLGVPTLS
IVASTASSVALILLLVVLFVLLQPKLKSFHHSRRDQGVSGDQVSIMVDGVQVALPSYEEA
VYGSSGHCVPPADPRVQIVLSEGSGPSGRSVPREQQLPDQGACSSAGGEDEAPGQSGLCE
AWGSRASETVMVHQATTSSWVAGSGNRQLAHKETADSENSDIQSLLSLTSEEYTDDIPLL
KEA
Sequence length 303
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ANDROGENETIC ALOPECIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ASTHMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Carcinogenesis Carcinogenesis Pubtator 33914752 Associate
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer BEFREE 21619678
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 21619678 Associate
★☆☆☆☆
Found in Text Mining only
Leukemia Leukemia Pubtator 37557169 Associate
★☆☆☆☆
Found in Text Mining only
Leukemia Myeloid Acute Myeloid leukemia Pubtator 37557169 Associate
★☆☆☆☆
Found in Text Mining only
Lymphatic Metastasis Lymphatic metastasis Pubtator 29451718 Inhibit
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 21619678
★☆☆☆☆
Found in Text Mining only
Non-Small Cell Lung Carcinoma Lung carcinoma BEFREE 29451718
★☆☆☆☆
Found in Text Mining only