Gene Gene information from NCBI Gene database.
Entrez ID 976
Gene name Adhesion G protein-coupled receptor E5
Gene symbol ADGRE5
Synonyms (NCBI Gene)
CD97TM7LN1
Chromosome 19
Chromosome location 19p13.12
Summary This gene encodes a member of the EGF-TM7 subfamily of adhesion G protein-coupled receptors, which mediate cell-cell interactions. These proteins are cleaved by self-catalytic proteolysis into a large extracellular subunit and seven-span transmembrane sub
miRNA miRNA information provided by mirtarbase database.
10
miRTarBase ID miRNA Experiments Reference
MIRT438175 hsa-miR-126-3p FACSFlowGFP reporter assayLuciferase reporter assayqRT-PCR 24274104
MIRT438175 hsa-miR-126-3p FACSFlowGFP reporter assayLuciferase reporter assayqRT-PCR 24274104
MIRT438175 hsa-miR-126-3p FACSFlowGFP reporter assayLuciferase reporter assayqRT-PCR 24274104
MIRT438175 hsa-miR-126-3p FACSFlowGFP reporter assayLuciferase reporter assayqRT-PCR 24274104
MIRT438175 hsa-miR-126-3p FACSFlowGFP reporter assayLuciferase reporter assayqRT-PCR 24274104
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Transcription factor Regulation Reference
SP1 Activation 18329191
SP3 Activation 18329191
WT1 Activation 22313360
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
28
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0004888 Function Transmembrane signaling receptor activity IEA
GO:0004888 Function Transmembrane signaling receptor activity TAS 7636245
GO:0004930 Function G protein-coupled receptor activity IBA
GO:0004930 Function G protein-coupled receptor activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601211 1711 ENSG00000123146
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P48960
Protein name Adhesion G protein-coupled receptor E5 (Leukocyte antigen CD97) (CD antigen CD97) [Cleaved into: Adhesion G protein-coupled receptor E5 subunit alpha; Adhesion G protein-coupled receptor E5 subunit beta]
Protein function Receptor potentially involved in both adhesion and signaling processes early after leukocyte activation. Plays an essential role in leukocyte migration.
PDB 2BOU , 7DO4 , 7YDH , 7YDJ , 7YDM , 7YDP , 8IKJ , 8IKL
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07645 EGF_CA 64 114 Calcium-binding EGF domain Domain
PF07645 EGF_CA 116 158 Calcium-binding EGF domain Domain
PF07645 EGF_CA 160 207 Calcium-binding EGF domain Domain
PF07645 EGF_CA 209 256 Calcium-binding EGF domain Domain
PF01825 GPS 493 536 GPCR proteolysis site, GPS, motif Motif
PF00002 7tm_2 544 782 7 transmembrane receptor (Secretin family) Family
Tissue specificity TISSUE SPECIFICITY: Broadly expressed, found on most hematopoietic cells, including activated lymphocytes, monocytes, macrophages, dendritic cells, and granulocytes. Expressed also abundantly by smooth muscle cells. Expressed in thyroid, colorectal, gastr
Sequence
MGGRVFLAFCVWLTLPGAETQDSRGCARWCPQNSSCVNATACRCNPGFSSFSEIITTPTE
TCDDINECATPSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDEC
QQNPRLCKSYGTCVNTLGSYTCQCLPGFKFIPEDPKVC
TDVNECTSGQNPCHSSTHCLNN
VGSYQCRCRPGWQPIPGSPNGPNNTVC
EDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPG
WKPRHGIPNNQKDTVC
EDMTFSTWTPPPGVHSQTLSRFFDKVQDLGRDSKTSSAEVTIQN
VIKLVDELMEAPGDVEALAPPVRHLIATQLLSNLEDIMRILAKSLPKGPFTYISPSNTEL
TLMIQERGDKNVTMGQSSARMKLNWAVAAGAEDPGPAVAGILSIQNMTTLLANASLNLHS
KKQAELEEIYESSIRGVQLRRLSAVNSIFLSHNNTKELNSPILFAFSHLESSDGEAGRDP
PAKDVMPGPRQELLCAFWKSDSDRGGHWATEGCQVLGSKNGSTTCQCSHLSSFAILMAHY
DVEDWKLTLITRVGLALSLFCLLLCILTFLLVRPIQGSRTTIHLHLCICLFVGSTIFLAG
IENEGGQVGLRCRLVAGLLHYCFLAAFCWMSLEGLELYFLVVRVFQGQGLSTRWLCLIGY
GVPLLIVGVSAAIYSKGYGRPRYCWLDFEQGFLWSFLGPVTFIILCNAVIFVTTVWKLTQ
KFSEINPDMKKLKKARALTITAIAQLFLLGCTWVFGLFIFDDRSLVLTYVFTILNCLQGA
FL
YLLHCLLNKKVREEYRKWACLVAGGSKYSEFTSTTSGTGHNQTRALRASESGI
Sequence length 835
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Class B/2 (Secretin family receptors)
Neutrophil degranulation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
11
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Lung cancer Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute Undifferentiated Leukemia Leukemia BEFREE 31260716, 31371381
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma BEFREE 12414513, 12761622, 22768192
★☆☆☆☆
Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma B-cell Lymphoma BEFREE 30953469
★☆☆☆☆
Found in Text Mining only
Anaplasia Anaplasia BEFREE 12414513, 12428789, 15386373, 22768192, 22797060, 29704239, 30883974, 9135025
★☆☆☆☆
Found in Text Mining only
Anaplastic astrocytoma Anaplastic Astrocytoma BEFREE 25714433
★☆☆☆☆
Found in Text Mining only
Anaplastic carcinoma Anaplastic Carcinoma BEFREE 9135025
★☆☆☆☆
Found in Text Mining only
Arthritis Arthritis BEFREE 20131275
★☆☆☆☆
Found in Text Mining only
Arthritis Rheumatoid Rheumatoid arthritis Pubtator 15693006, 33992645 Associate
★☆☆☆☆
Found in Text Mining only
Brain Neoplasms Brain Neoplasms BEFREE 25714433
★☆☆☆☆
Found in Text Mining only
Brain Neoplasms Brain neoplasms Pubtator 25714433 Associate
★☆☆☆☆
Found in Text Mining only