Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	9753
Gene name	Zinc finger and SCAN domain containing 12
Gene symbol	ZSCAN12
Synonyms (NCBI Gene)	ZFP96ZNF29K1ZNF305ZNF96dJ29K1.2
Chromosome	6
Chromosome location	6p22.1

105

Show/Hide all (105)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028303	hsa-miR-32-5p	Sequencing	20371350
MIRT544414	hsa-miR-548ae-3p	PAR-CLIP	21572407
MIRT544413	hsa-miR-548ah-3p	PAR-CLIP	21572407
MIRT544412	hsa-miR-548aj-3p	PAR-CLIP	21572407
MIRT544411	hsa-miR-548am-3p	PAR-CLIP	21572407
MIRT544410	hsa-miR-548aq-3p	PAR-CLIP	21572407
MIRT544409	hsa-miR-548j-3p	PAR-CLIP	21572407
MIRT544408	hsa-miR-548x-3p	PAR-CLIP	21572407
MIRT317365	hsa-miR-5582-3p	PAR-CLIP	21572407
MIRT544407	hsa-miR-4311	PAR-CLIP	21572407
MIRT544406	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT028303	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT544405	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT544404	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT544403	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT544402	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT544401	hsa-miR-6515-3p	PAR-CLIP	21572407
MIRT544400	hsa-miR-1236-3p	PAR-CLIP	21572407
MIRT544399	hsa-miR-4753-3p	PAR-CLIP	21572407
MIRT544398	hsa-miR-653-5p	PAR-CLIP	21572407
MIRT544397	hsa-miR-6809-3p	PAR-CLIP	21572407
MIRT544414	hsa-miR-548ae-3p	PAR-CLIP	21572407
MIRT544413	hsa-miR-548ah-3p	PAR-CLIP	21572407
MIRT544412	hsa-miR-548aj-3p	PAR-CLIP	21572407
MIRT544411	hsa-miR-548am-3p	PAR-CLIP	21572407
MIRT544410	hsa-miR-548aq-3p	PAR-CLIP	21572407
MIRT544409	hsa-miR-548j-3p	PAR-CLIP	21572407
MIRT544408	hsa-miR-548x-3p	PAR-CLIP	21572407
MIRT317365	hsa-miR-5582-3p	PAR-CLIP	21572407
MIRT544407	hsa-miR-4311	PAR-CLIP	21572407
MIRT544406	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT028303	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT544405	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT544404	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT544403	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT544402	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT544401	hsa-miR-6515-3p	PAR-CLIP	21572407
MIRT544400	hsa-miR-1236-3p	PAR-CLIP	21572407
MIRT544399	hsa-miR-4753-3p	PAR-CLIP	21572407
MIRT544398	hsa-miR-653-5p	PAR-CLIP	21572407
MIRT544397	hsa-miR-6809-3p	PAR-CLIP	21572407
MIRT544414	hsa-miR-548ae-3p	PAR-CLIP	21572407
MIRT544413	hsa-miR-548ah-3p	PAR-CLIP	21572407
MIRT544412	hsa-miR-548aj-3p	PAR-CLIP	21572407
MIRT544411	hsa-miR-548am-3p	PAR-CLIP	21572407
MIRT544410	hsa-miR-548aq-3p	PAR-CLIP	21572407
MIRT544409	hsa-miR-548j-3p	PAR-CLIP	21572407
MIRT544408	hsa-miR-548x-3p	PAR-CLIP	21572407
MIRT317365	hsa-miR-5582-3p	PAR-CLIP	21572407
MIRT544407	hsa-miR-4311	PAR-CLIP	21572407
MIRT544406	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT028303	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT544405	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT544404	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT544403	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT544402	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT544401	hsa-miR-6515-3p	PAR-CLIP	21572407
MIRT544400	hsa-miR-1236-3p	PAR-CLIP	21572407
MIRT544399	hsa-miR-4753-3p	PAR-CLIP	21572407
MIRT544398	hsa-miR-653-5p	PAR-CLIP	21572407
MIRT544397	hsa-miR-6809-3p	PAR-CLIP	21572407
MIRT544414	hsa-miR-548ae-3p	PAR-CLIP	21572407
MIRT544413	hsa-miR-548ah-3p	PAR-CLIP	21572407
MIRT544412	hsa-miR-548aj-3p	PAR-CLIP	21572407
MIRT544411	hsa-miR-548am-3p	PAR-CLIP	21572407
MIRT544410	hsa-miR-548aq-3p	PAR-CLIP	21572407
MIRT544409	hsa-miR-548j-3p	PAR-CLIP	21572407
MIRT544408	hsa-miR-548x-3p	PAR-CLIP	21572407
MIRT317365	hsa-miR-5582-3p	PAR-CLIP	21572407
MIRT544407	hsa-miR-4311	PAR-CLIP	21572407
MIRT544406	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT028303	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT544405	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT544404	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT544403	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT544402	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT544401	hsa-miR-6515-3p	PAR-CLIP	21572407
MIRT544400	hsa-miR-1236-3p	PAR-CLIP	21572407
MIRT544399	hsa-miR-4753-3p	PAR-CLIP	21572407
MIRT544398	hsa-miR-653-5p	PAR-CLIP	21572407
MIRT544397	hsa-miR-6809-3p	PAR-CLIP	21572407
MIRT1543521	hsa-miR-3117-3p	CLIP-seq
MIRT1543522	hsa-miR-3155	CLIP-seq
MIRT1543523	hsa-miR-3155b	CLIP-seq
MIRT1543524	hsa-miR-3162-5p	CLIP-seq
MIRT1543525	hsa-miR-3169	CLIP-seq
MIRT1543526	hsa-miR-3942-3p	CLIP-seq
MIRT1543527	hsa-miR-4481	CLIP-seq
MIRT1543528	hsa-miR-4654	CLIP-seq
MIRT1543529	hsa-miR-4745-5p	CLIP-seq
MIRT1543530	hsa-miR-4758-5p	CLIP-seq
MIRT1543531	hsa-miR-4759	CLIP-seq
MIRT1543532	hsa-miR-4769-5p	CLIP-seq
MIRT1543533	hsa-miR-484	CLIP-seq
MIRT1543534	hsa-miR-563	CLIP-seq
MIRT1543535	hsa-miR-579	CLIP-seq
MIRT1543536	hsa-miR-659	CLIP-seq
MIRT1543537	hsa-miR-664	CLIP-seq
MIRT1543538	hsa-miR-892a	CLIP-seq
MIRT2383168	hsa-miR-1245b-5p	CLIP-seq
MIRT2383169	hsa-miR-3142	CLIP-seq
MIRT2383170	hsa-miR-335	CLIP-seq
MIRT2383171	hsa-miR-4277	CLIP-seq
MIRT2383172	hsa-miR-513c	CLIP-seq
MIRT2383173	hsa-miR-514b-5p	CLIP-seq

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	21516116, 25416956, 32296183, 32814053
GO:0005634	Component	Nucleus	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

MIM	HGNC	e!Ensembl
603978	13172	ENSG00000158691

O43309

Protein name

Zinc finger and SCAN domain-containing protein 12 (Zinc finger protein 305) (Zinc finger protein 96)

Protein function

May be involved in transcriptional regulation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02023	SCAN	42 → 131	SCAN domain	Domain
PF00096	zf-C2H2	274 → 296	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	302 → 324	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	330 → 352	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	358 → 380	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	386 → 408	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	414 → 437	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	442 → 463	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	469 → 491	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	497 → 519	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	525 → 547	Zinc finger, C2H2 type	Domain

Sequence

MASTWAIQAHMDQDEPLEVKIEEEKYTTRQDWDLRKNNTHSREVFRQYFRQFCYQETSGP
REALSRLRELCHQWLRPETHTKEQILELLVLEQFLTILPEELQAWVQEQHPESGEEVVTV
LEDLERELDEPGEQVSVHTGEQEMFLQETVRLRKEGEPSMSLQSMKAQPKYESPELESQQ
EQVLDVETGNEYGNLKQEVSEEMEPHGKTSSKFENDMSKSARCGETREPEEITEEPSACS
REDKQPTCDENGVSLTENSDHTEHQRICPGEESYGCDDCGKAFSQHSHLIEHQRIHTGDR
PYKCEECGKAFRGRTVLIRHKIIHTGEKPYKCNECGKAFGRWSALNQHQRLHTGEKHYHC
NDCGKAFSQKAGLFHHIKIHTRDKPYQCTQCNKSFSRRSILTQHQGVHTGAKPYECNECG
KAFVYNSSLVSHQEIHHKEKCYQCKECGKSFSQSGLIQHQRIHTGEKPYKCDVCEKAFIQ
RTSLTEHQRIHTGERPYKCDKCGKAFTQRSVLTEHQRIHTGERPYKCDECGNAFRGITSL
IQHQRIHTGEKPYQCDECGKAFRQRKKTSYKEILLKNHSEPQAGVNLLLSSLIPEWQSCF
RRDL

Sequence length

604

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (16)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR POSITIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28167242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28167242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36001862	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28167242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32332753	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	GWASCAT_DG	26651848		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	31425724		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of lung	Lung carcinoma	GWASCAT_DG	28604730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35039565	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ZSCAN12 (zinc finger and SCAN domain containing 12)