HDAC9 (histone deacetylase 9)

Gene

• Entrez ID: 9734
• Gene name: Histone deacetylase 9
• Gene symbol: HDAC9
• Synonyms (NCBI Gene): ARCND4, HD7, HD7b, HD9, HDAC, HDAC7, HDAC7B, HDAC9B, HDAC9FL, HDRP, MITR
• Chromosome: 7
• Chromosome location: 7p21.1
• Summary: Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene h

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT610224	hsa-miR-8485	HITS-CLIP	23824327
MIRT610224	hsa-miR-8485	HITS-CLIP	23824327
MIRT610223	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT731680	hsa-miR-29a-5p	Luciferase reporter assay, Western blot	26441331
MIRT731680	hsa-miR-29a-5p	Luciferase reporter assay, Western blot	26441331
MIRT734303	hsa-miR-3619-5p	Luciferase reporter assay, qRT-PCR, Western blotting	33693951
MIRT735041	hsa-miR-211-5p	Luciferase reporter assay, Western blotting, qRT-PCR	32893379
MIRT610224	hsa-miR-8485	HITS-CLIP	23824327
MIRT610224	hsa-miR-8485	HITS-CLIP	23824327
MIRT610223	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT755375	hsa-miR-574-5p	Luciferase reporter assay, Western blotting, qRT-PCR	34976438
MIRT1042565	hsa-miR-4263	CLIP-seq
MIRT1042566	hsa-miR-4735-5p	CLIP-seq
MIRT1042567	hsa-miR-576-5p	CLIP-seq
MIRT1042568	hsa-miR-2110	CLIP-seq
MIRT1042569	hsa-miR-3147	CLIP-seq
MIRT1042570	hsa-miR-3150a-3p	CLIP-seq
MIRT1042571	hsa-miR-3653	CLIP-seq
MIRT1042572	hsa-miR-4425	CLIP-seq
MIRT1042573	hsa-miR-4450	CLIP-seq
MIRT1042574	hsa-miR-4781-3p	CLIP-seq
MIRT1042575	hsa-miR-488	CLIP-seq
MIRT1042576	hsa-miR-548ag	CLIP-seq
MIRT1042577	hsa-miR-548ai	CLIP-seq
MIRT1042578	hsa-miR-548m	CLIP-seq
MIRT1042571	hsa-miR-3653	CLIP-seq
MIRT1042575	hsa-miR-488	CLIP-seq
MIRT1042576	hsa-miR-548ag	CLIP-seq
MIRT1042577	hsa-miR-548ai	CLIP-seq
MIRT1042578	hsa-miR-548m	CLIP-seq
MIRT1042568	hsa-miR-2110	CLIP-seq
MIRT1042569	hsa-miR-3147	CLIP-seq
MIRT1042570	hsa-miR-3150a-3p	CLIP-seq
MIRT1042572	hsa-miR-4425	CLIP-seq
MIRT2241371	hsa-miR-4447	CLIP-seq
MIRT1042573	hsa-miR-4450	CLIP-seq
MIRT2241372	hsa-miR-4472	CLIP-seq
MIRT1042574	hsa-miR-4781-3p	CLIP-seq
MIRT2682232	hsa-miR-1305	CLIP-seq
MIRT2682233	hsa-miR-4775	CLIP-seq
MIRT2682234	hsa-miR-590-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
GATA4	Repression	18332107
SALL3	Repression	18332107

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000118	Component	Histone deacetylase complex	IBA
GO:0000118	Component	Histone deacetylase complex	TAS	12711221
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	10655483
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	11535832
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0001818	Process	Negative regulation of cytokine production	IDA	28855441
GO:0003714	Function	Transcription corepressor activity	ISS
GO:0004407	Function	Histone deacetylase activity	IBA
GO:0004407	Function	Histone deacetylase activity	IDA	10655483
GO:0004407	Function	Histone deacetylase activity	IDA	11535832, 12590135
GO:0004407	Function	Histone deacetylase activity	IEA
GO:0005080	Function	Protein kinase C binding	IPI	20188095
GO:0005515	Function	Protein binding	IPI	12590135, 16147992, 20211142, 20936779, 26221039
GO:0005634	Component	Nucleus	IDA	12590135, 20188095
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IDA	15567413, 19303849
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	12590135, 20188095
GO:0005737	Component	Cytoplasm	TAS	12711221
GO:0006325	Process	Chromatin organization	IEA
GO:0006954	Process	Inflammatory response	TAS	12711221
GO:0007507	Process	Heart development	ISS
GO:0010558	Process	Negative regulation of macromolecule biosynthetic process	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030183	Process	B cell differentiation	TAS	12711221
GO:0031078	Function	Histone H3K14 deacetylase activity, hydrolytic mechanism	ISS	21708950
GO:0032129	Function	Histone H3K9 deacetylase activity, hydrolytic mechanism	ISS	21708950
GO:0032869	Process	Cellular response to insulin stimulus	IDA	19303849
GO:0033558	Function	Protein lysine deacetylase activity	IDA	11535832
GO:0033558	Function	Protein lysine deacetylase activity	IEA
GO:0034739	Function	Histone H4K16 deacetylase activity, hydrolytic mechanism	IDA	28855441
GO:0035097	Component	Histone methyltransferase complex	ISS
GO:0040029	Process	Epigenetic regulation of gene expression	IBA
GO:0042113	Process	B cell activation	TAS	12711221
GO:0042632	Process	Cholesterol homeostasis	IDA	28855441
GO:0042826	Function	Histone deacetylase binding	IDA	10655483
GO:0042826	Function	Histone deacetylase binding	IPI	12590135
GO:0045814	Process	Negative regulation of gene expression, epigenetic	IDA	11535832, 12590135, 28855441
GO:0045814	Process	Negative regulation of gene expression, epigenetic	ISS	21708950
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	10655483, 11535832
GO:0046872	Function	Metal ion binding	IEA
GO:0048742	Process	Regulation of skeletal muscle fiber development	ISS
GO:0051153	Process	Regulation of striated muscle cell differentiation	ISS
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IDA	11535832
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	15567413, 19303849
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	IMP	19351956
GO:0140297	Function	DNA-binding transcription factor binding	IDA	12590135
GO:0140297	Function	DNA-binding transcription factor binding	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	10748098, 17360565
GO:0140297	Function	DNA-binding transcription factor binding	ISS
GO:0141221	Function	Histone deacetylase activity, hydrolytic mechanism	IEA

Other IDs

• MIM: 606543
• HGNC: 14065
• e!Ensembl: ENSG00000048052

Protein

• UniProt ID: Q9UKV0
• Protein name: Histone deacetylase 9 (HD9) (EC 3.5.1.98) (Histone deacetylase 7B) (HD7) (HD7b) (Histone deacetylase-related protein) (MEF2-interacting transcription repressor MITR)
• Protein function: Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell c
• PDB: 8Q9N, 8Q9R
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12203	HDAC4_Gln	37 → 124	Glutamine rich N terminal domain of histone deacetylase 4	Family
  PF00850	Hist_deacetyl	654 → 972	Histone deacetylase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Broadly expressed, with highest levels in brain, heart, muscle and testis. Isoform 3 is present in human bladder carcinoma cells (at protein level). {ECO:0000269|PubMed:10655483, ECO:0000269|PubMed:11535832, ECO:0000269|PubMed:12590135
• Sequence:

  MHSMISSVDVKSEVPVGLEPISPLDLRTDLRMMMPVVDPVVREKQLQQELLLIQQQQQIQ
  KQLLIAEFQKQHENLTRQHQAQLQEHIKELLAIKQQQELLEKEQKLEQQRQEQEVERHRR
  EQQLPPLRGKDRGRERAVASTEVKQKLQEFLLSKSATKDTPTNGKNHSVSRHPKLWYTAA
  HHTSLDQSSPPLSGTSPSYKYTLPGAQDAKDDFPLRKTASEPNLKVRSRLKQKVAERRSS
  PLLRRKDGNVVTSFKKRMFEVTESSVSSSSPGSGPSSPNNGPTGSVTENETSVLPPTPHA
  EQMVSQQRILIHEDSMNLLSLYTSPSLPNITLGLPAVPSQLNASNSLKEKQKCETQTLRQ
  GVPLPGQYGGSIPASSSHPHVTLEGKPPNSSHQALLQHLLLKEQMRQQKLLVAGGVPLHP
  QSPLATKERISPGIRGTHKLPRHRPLNRTQSAPLPQSTLAQLVIQQQHQQFLEKQKQYQQ
  QIHMNKLLSKSIEQLKQPGSHLEEAEEELQGDQAMQEDRAPSSGNSTRSDSSACVDDTLG
  QVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQPFLEPTHTRALSVRQAPLAAVGMDGL
  EKHRLVSRTHSSPAASVLPHPAMDRPLQPGSATGIAYDPLMLKHQCVCGNSTTHPEHAGR
  IQSIWSRLQETGLLNKCERIQGRKASLEEIQLVHSEHHSLLYGTNPLDGQKLDPRILLGD
  DSQKFFSSLPCGGLGVDSDTIWNELHSSGAARMAVGCVIELASKVASGELKNGFAVVRPP
  GHHAEESTAMGFCFFNSVAITAKYLRDQLNISKILIVDLDVHHGNGTQQAFYADPSILYI
  SLHRYDEGNFFPGSGAPNEVGTGLGEGYNINIAWTGGLDPPMGDVEYLEAFRTIVKPVAK
  EFDPDMVLVSAGFDALEGHTPPLGGYKVTAKCFGHLTKQLMTLADGRVVLALEGGHDLTA
  ICDASEACVNALLGNELEPLAEDILHQSPNMNAVISLQKIIEIQSMSLKFS

• Sequence length: 1011

Pathways

KEGG:

Neutrophil extracellular trap formation
Alcoholism
Viral carcinogenesis

Reactome:

Constitutive Signaling by NOTCH1 PEST Domain Mutants
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
Notch-HLH transcription pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AURICULOCONDYLAR SYNDROME	—	ClinGen	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AURICULOCONDYLAR SYNDROME 4	—	ClinVar, Disgenet, GenCC, HPO ClinVar, Disgenet, GenCC, HPO ClinVar, Disgenet, GenCC, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ANEURYSM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL AMYLOID ANGIOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR ACCIDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CIRRHOSIS OF LIVER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ATHEROSCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSLEXIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LARGE ARTERY STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOYAMOYA DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS OF HIP	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	CTD, GWAS catalog CTD, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL ARTERIAL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL VASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	CTD, GWAS catalog CTD, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acne	Acne	BEFREE	30737272		★☆☆☆☆ Found in Text Mining only
Acne Vulgaris	Acne	BEFREE	30737272		★☆☆☆☆ Found in Text Mining only
Acute Cerebrovascular Accidents	Stroke	CTD_human_DG	22306652		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	27642596		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	29978456		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	18349321, 20636436, 28690313		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	30034592		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	22820861, 24566867		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	19912635		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	24650256, 29140794		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	18349321		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	28756223		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	20415600, 20880107		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	20413433, 22406992, 30944042		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	25109799		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	GWASCAT_DG	28196072		★☆☆☆☆ Found in Text Mining only
Alopecia, Androgenetic, 1	Androgenetic Alopecia	GWASCAT_DG	22693459, 27182965, 29146897		★☆☆☆☆ Found in Text Mining only
Alopecia, Androgenetic, 2	Androgenetic Alopecia	GWASCAT_DG	22693459, 27182965, 29146897		★☆☆☆☆ Found in Text Mining only
Alopecia, Androgenetic, 3	Androgenetic Alopecia	GWASCAT_DG	22693459, 27182965, 29146897		★☆☆☆☆ Found in Text Mining only
Alopecia, Male Pattern	Alopecia, Male Pattern	BEFREE	22032556		★☆☆☆☆ Found in Text Mining only
Alopecia, Male Pattern	Alopecia, Male Pattern	GWASCAT_DG	22693459, 27182965, 29146897		★☆☆☆☆ Found in Text Mining only
Alopecia, Male Pattern	Alopecia, Male Pattern	GWASDB_DG	22693459		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	20221449, 24005853, 24200051, 29458411, 36039594	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease	Alzheimer disease	Pubtator	29458411	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyloidosis	Amyloidosis	BEFREE	30593950		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	24312501	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	30713114, 31241177		★☆☆☆☆ Found in Text Mining only
Androgenetic Alopecia	Androgenetic Alopecia	GWASCAT_DG	22693459, 27182965, 29146897		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia	Anemia	Pubtator	34036344	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	26466379	Associate	★☆☆☆☆ Found in Text Mining only
Angelman Syndrome	Angelman Syndrome	BEFREE	28576709		★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	26586478	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	22724461, 24675724, 25035344, 25388417, 26347468, 27100479, 31736752		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	20959025, 24039666, 25452308, 27736946, 38241560	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	12070353	Inhibit	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	22156779, 25307458, 31375426		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	32119686	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	18713462	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	21508384		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	24512718	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	23449258, 26347468, 27100479, 32284067, 35941971	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	24675724, 25035344, 25388417, 26347468, 27100479, 31736752		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial fibrillation	Pubtator	27034410	Inhibit	★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	29458411		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	37280359	Associate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	24768552	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	21708950, 29958625, 31710483		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	27034410, 32231389, 39329199	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	27799148, 28270022		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	GWASCAT_DG	26806518		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	32641695	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	16397266, 28363998		★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	29651704	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	29452136, 30031609		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	37324938	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	30348136	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17227585, 21971930, 23159930, 23364277, 23402757, 23414320, 23435418, 23519125, 24481780, 25801958, 26777440, 26930713, 27197203, 28011471, 29741645, 29759486, 29963106, 30901675, 31099456, 31111958, 31429292, 31519896		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11744689, 15155736, 16778215, 19460134, 20049865, 20388208, 21452019, 22083351, 23354309, 23435418, 23627572, 23926105, 25287138, 26378038, 26771717, 26862729, 26915294, 26930713, 27292433, 28966246, 29155146, 29689276, 30268765, 30352569, 31099456, 31273285, 31900196, 32686908, 33885658, 36604412, 37047202, 37459799, 38206773	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17227585, 28919751	Inhibit	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	17596302	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	28932644		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	40021103	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23627572, 23784969, 24427341, 26930713, 31365693, 32701251	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	21367844, 34312479	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	28426972, 32466769	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	15467438, 36713456	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	20165882, 21206745, 21737444, 22223166, 23403953, 24304587, 24833845, 25292076, 25613642, 26352599, 27342975, 30443188, 35724265	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	37071208	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	16397266, 28363998		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15305372, 16163707, 20811718, 23273563, 26101014		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	23390377	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	38240084	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	16096370, 18769122, 30463940	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	31125117	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22629454, 23784969, 24394434	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	30268765		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	27681437, 29590609, 30519361		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	34257602	Associate	★☆☆☆☆ Found in Text Mining only
Cardioembolic stroke	Cardioembolic Stroke	BEFREE	23041239, 26935894		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	32650632	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	27034410	Inhibit	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	23449258, 32284067	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	23449258		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	23449258	Stimulate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	23449258, 28343758	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	19784544	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage Diseases	BEFREE	28827187		★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia, Mental Retardation, And Dysequilibrium Syndrome 1	Cerebellar Ataxia, Mental Retardation, And Dysequilibrium Syndrome	BEFREE	30511269		★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	GWASCAT_DG	29458411		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	Pubtator	29458411	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Infarction	Ischemic stroke	Pubtator	22306652, 22776031, 23449258, 26347468, 28975602, 29247141, 36691064	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral microangiopathy	Pubtator	28975602	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	22306652, 22776031, 23041239, 23449258, 23828597, 25035344, 25256182, 25388417, 26089329, 26347468, 26621503, 26708676, 27642596, 28145521, 28975602, 28982677, 29247141, 29651704, 30031609, 30565168, 31500558		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	GWASDB_DG	22306652		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	GWASCAT_DG	22306652, 26089329		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	CTD_human_DG	22306652		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	18349321		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	20413433, 22406992, 30944042		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	23725164, 34211100	Associate	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	23893747, 26247786	Associate	★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	30074176		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	30776024		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	19710697, 27507882, 28445158		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	21806350, 22579713		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	23275209, 31191307		★☆☆☆☆ Found in Text Mining only
Chronobiology Disorders	Chronobiology disorder	Pubtator	27034410	Inhibit	★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	32524326	Associate	★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne Syndrome	BEFREE	30158153		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	20010553		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	29907492, 36039594	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	12584561, 17657594, 18789002, 19948057, 20878117, 21317455, 21523445, 28264628, 28418886		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	23724141	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19270508, 19521961, 21464950, 23011889, 25813020, 27283986, 28176652, 28415009		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16887021, 16982769, 17720775, 18419600, 19270508, 19521961, 19528666, 19881542, 21464950, 21624135, 23011889, 23770684, 23880304, 24172061, 24324066, 24346863, 26343742, 28176652, 28180300, 28954936, 30257705, 31064417, 31434255, 31856851, 31941522, 36343387, 37561735, 37764423, 37934338, 38447451	Associate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	30862568		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	12918547, 30074176, 30126190		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	22826467, 28939740, 30872677		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	25388417, 27494404, 27642596, 31500558		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASDB_DG	23202125		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	25388417, 27494404, 27642596, 31500558		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	27494404, 27642596	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	25388417, 27494404, 27642596, 31500558		★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	34980138	Associate	★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing`s Syndrome	BEFREE	28928236		★☆☆☆☆ Found in Text Mining only
Cushing's symphalangism	Proximal symphalangism	Pubtator	22306652, 22776031, 23828597	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	19411311, 32524326	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	28478266		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28827187		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	19759294, 28778545		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	19759294		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	30530989	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	31477543		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28886276	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	31477543		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	28733598, 32677473	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	24120624, 26420860, 28733598, 30088095		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	32677473	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	31199706		★☆☆☆☆ Found in Text Mining only
Diffuse Intrinsic Pontine Glioma	Diffuse Intrinsic Pontine Glioma	BEFREE	28434841		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	21772049, 25494542, 27799148, 28352655, 28756223, 29721185, 29876933		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	22343305, 23530769, 23888962		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	28516379, 32107418	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	22344732		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	GWASCAT_DG	26220383		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	BEFREE	29076408		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	24459703		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	25923331	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25923331, 27826618	Associate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	26466379		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	17767915		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	31236923		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	28712747	Associate	★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	19860841		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	35075805	Associate	★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	22160715		★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	22160715	Associate	★☆☆☆☆ Found in Text Mining only
Geographic Atrophy	Geographic Atrophy	BEFREE	25109799		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	18445700, 19583803, 21653597, 22406992, 30348136, 30654849, 33987681, 34638754, 35260183, 35269397, 36766715	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22270849, 25305451, 25760078, 25993039, 26260271, 26794465, 27632183, 30209569, 31531023		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22270849, 25305451, 25760078, 25993039, 26260271, 26794465, 27632183, 30209569, 31531023		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	18445700, 22406992, 24351423, 33130903, 35365623, 35545840, 36227941, 36766715, 37528157, 37603953, 38306270	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29284798, 30837601, 31711240		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	28220539		★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	30776024		★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	28035377		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	23874019	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	39329199	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	30765872		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	23527004, 30765872	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	22865920, 32410704	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	27034410	Inhibit	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	12918547, 30126190		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	32618141	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure, Right-Sided	Heart Failure	BEFREE	31749139		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	12590135, 18774777, 22826467, 27913271, 30332548		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	12590135, 16914725, 24114842, 26915294, 36604412	Associate	★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	30353642		★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	28733598	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	27635950	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	30993446		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	28700998		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	18541724, 19775297	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	20415600, 20880107		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	21913121, 24933366	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	22590724, 23800350, 28175299, 30150378		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	30124006		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	28928236		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	23393555, 28567090, 28928236		★☆☆☆☆ Found in Text Mining only
HYPOPLASTIC LEFT HEART SYNDROME 1	Hypoplastic Left Heart Syndrome	BEFREE	29569026		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21670155	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	31273285	Inhibit	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31749139		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	19487460, 28467787, 30481203	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	26359372, 31110176		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	27034410	Associate	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	27761824		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	20010553, 26280576, 31796106		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	23771909	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	25256182, 30919159		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	31250579, 37573538	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	31704828		★☆☆☆☆ Found in Text Mining only
Irido-corneo-trabecular dysgenesis (disorder)	Anterior segment dysgenesis	BEFREE	12706107		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	22306652, 22776031, 23449258, 26093197, 26347468, 28975602, 29247141, 30031609, 30656483		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	GWASCAT_DG	26708676		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	23697938		★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	GWASCAT_DG	27927641		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	35189973	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	30776024		★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	28419090		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	28300476	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	22419440, 28419090, 31754707	Associate	★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	30785874, 31754707		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	30785874	Inhibit	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	24214631	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	15964800, 20385359, 21818379, 23247046, 23400519, 23536721, 26308964, 26329759, 27576506, 27766571, 28053092, 28972015, 29499113	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	25944469, 26329759, 27761809, 27766571, 28415009, 29467492, 29978456		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	20385359, 9150137	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	15466934, 15774615, 17993609, 18268283, 19736310, 20385359, 23247046, 24349422, 26858310, 27309669, 27576506, 33356802, 33384686, 34665271, 34714913	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	3167210	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Juvenile	Myelomonocytic leukemia	Pubtator	26891149	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	12239173, 22820861, 32783381	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	14628154, 16121216, 18206229, 18268283, 20385359, 22096027, 23940586, 27309669, 27485472, 28060870, 28548643, 30034592, 31766421		★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	28419090		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	21332579		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16583461, 17611778, 20842113, 23095110, 24958469, 25166596, 25613642, 25947292, 27342975, 27748761, 28262837, 28489564, 28646552, 29360739, 30108831, 30151243, 30198057, 30342168, 31078148, 31228075, 31261976, 31757742		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	16583461		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	29301535		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	18047684, 18708766, 20811718, 22701735, 23273563, 24512221, 29079711, 32701251, 34203519, 38280930, 39179249, 40650414	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24427341	Inhibit	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28099148	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	21327298, 25791245		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	21327298, 25791245		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	21327298, 25791245, 28097234, 31708928		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	21327298, 25791245		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	15713621, 19775297, 22160379, 25671298, 26314218, 28731463, 30385631, 31912905, 33513156	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	21132350, 22160379, 25671298, 27799148, 28447074, 30899436		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	30348636	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	21132350, 28416758, 31523396		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	28416758, 31523396		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	17504226, 22416775, 26660520, 27422033, 27511598, 28625481, 30124006, 30173294, 30529073, 31358475		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	27799148		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	32394008	Associate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	33921543	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	28559159, 29096654		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	30765872		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17227585, 19263197, 19794300, 23159930, 23364277, 23402757, 23414320, 23435418, 23519125, 24481780, 25801958, 26777440, 26930713, 27197203, 28011471, 28560068, 29741645, 29759486, 29963106, 30901675, 31099456, 31111958, 31429292, 31519896		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	23888962		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	15069698		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31078148		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15305372, 16163707, 20811718, 23273563, 26086099, 26101014		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	21332579		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	27681437, 29590609, 30519361		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19912635, 22147512, 24079712, 24810906, 27197284, 27281367, 27875574, 29238851, 29995287, 31269745		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pharynx	Malignant Pharyngeal Neoplasm	BEFREE	24079712		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18798265, 19384952, 19810103, 20227822, 20585447, 22114073, 27462923, 29327812, 29416632, 30551877, 31476841		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30867763, 31365693, 31451695		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	30125607, 31395086		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	16397266, 28363998		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11562754, 11710831, 15665816, 16044157, 17965606, 18824292, 19528037, 19585508, 19912635, 23291663, 23414309, 23482354, 23888962, 24261995, 24382391, 25364882, 25759362, 25762644, 25942572, 26396249, 26807602, 27197203, 27300436, 27358484, 27449083, 27511598, 27705911, 27748555, 27761823, 27761824, 28033734, 28062671, 28601509, 28611196, 28826913, 28963352, 29156535, 29259009, 29514055, 29519604, 29535070, 29665050, 29695769, 29733427, 30050079, 30066893, 30144430, 30288233, 30310596, 30417746, 30421914, 30484863, 30694564, 30842103, 30866966, 30901675, 31059004, 31067680, 31087305, 31096697, 31112703, 31247937, 31272794, 31325529, 31395086, 31431326, 31586401, 31692265, 31710483, 31773377, 31819161		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	26200462		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18789002, 19948057, 21317455, 21523445, 28264628, 28418886		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	23159930, 27197203, 30521787, 31099456		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	17329407, 22406992, 23567267, 32720471, 32822486	Associate	★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	20081843, 20413433, 22406992, 30944042		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	15314285, 25836739, 28445736, 30458450, 30709805, 30936219, 36130505, 37298104, 39567011	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29210065, 30936082, 30936219		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	38102708	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	19759294, 28778545		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	19759294, 19767015		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	26365275		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	25970771		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	25970771	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	23414309		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	32410704	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	23771909	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	22096249, 36039594	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	26473836	Stimulate	★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	19767015		★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	29391537		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11754398, 12531799, 14695887, 20447761, 21816815, 25978432, 27738323, 30387821	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	26429859, 27626482, 28270022, 29259009, 29774113, 30594434, 30954557, 30987296, 31325448, 31732653		★☆☆☆☆ Found in Text Mining only
Muscular Atrophy Spinal	Spinal muscular atrophy	Pubtator	18971205, 28879433	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	21308150		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	21308150		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	22059907		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	3167210	Inhibit	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	20385359		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	28301600, 31071955, 31698777, 31706847		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	22579713, 28331226		★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	31618641		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	28535287	Associate	★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	GWASDB_DG	19629137		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	34906623, 39174882	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	30348136	Inhibit	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12494463, 15305372, 17195089, 18824292, 19794300, 19860841, 19912635, 20880107, 21527555, 21635225, 21725604, 23140166, 23159930, 23291663, 23343772, 23784969, 24429254, 25427220, 25503779, 25760078, 25813020, 26306783, 26378038, 26614844, 26799588, 26965582, 27033599, 27600599, 27799148, 28033734, 28249907, 28360947, 28406482, 28603560, 28611196, 28646552, 28732326, 28838999, 28860342, 28882400, 28925878, 28963352, 28965432, 29140794, 29163826, 29259009, 29405973, 29695769, 29732991, 29876933, 29915428, 29923797, 30144430, 30176876, 30232145, 30429882, 30538293, 30694564, 30901675, 30987296, 31078148, 31090223, 31112703, 31113472, 31227503, 31326241, 31531023		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	20123018, 30332548		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	15685243, 18607002, 20811720, 21159612, 22863973, 35636260, 37957138, 38063204	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	21159612, 26306783, 26734995, 26914605, 27572323, 31262882		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	19261878, 20142042, 21913121, 23326422, 24933366, 26858181, 27034410, 31330099	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	24312501	Inhibit	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	20123018, 28033734, 28553323, 29355955, 30958639, 31421440		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	30223590		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	26965582, 30223590		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15305372, 16707469, 20856855, 22965008, 23461975, 24309938, 28138828, 28406482, 28749535, 29079711, 30831531, 31090223		★☆☆☆☆ Found in Text Mining only
NUT midline carcinoma	Carcinoma	BEFREE	21447744		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	19784544, 24107356	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis of hip	Osteoarthritis Of Hip	GWASCAT_DG	29559693, 30374069		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis of hip	Osteoarthritis Of Hip	CTD_human_DG	30374069		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	37324938	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	17310851, 25778932, 30509303		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	27877082, 40332124	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	27681437, 29590609, 30519361		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	17387270, 20404564, 21957481, 28073598, 28117030, 29976638, 31050342, 32517089, 33167494, 37063431	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19912635, 22147512, 24079712, 24810906, 27197284, 27281367, 27875574, 29238851, 29995287, 31269745		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	22487525		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	18181121, 18296916, 20145244, 27197284, 29374219, 31912905, 33227941, 36126055, 38240084	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	32524326	Associate	★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	3167210		★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	Pubtator	3167210	Inhibit	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30847387		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	31572723		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	26488411, 34601942	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Arterial Diseases	Vascular Diseases	GWASCAT_DG	26488411		★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	23382909, 27511598		★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	26811494	Associate	★☆☆☆☆ Found in Text Mining only
Peyronie Disease	Peyronie Disease	BEFREE	23770939		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	31439580		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	27915160		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	16054691, 21806350		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18798265, 19384952, 19810103, 20227822, 20585447, 22114073, 27462923, 29327812, 29416632, 30551877, 31476841		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	16186112, 16280330, 17970072, 18212746, 19528666, 20585447, 21862211, 21867506, 22114073, 22800507, 25127709, 25808196, 26429394, 27462923, 29211704, 29499113, 32459381, 34533293, 36050516, 37104249, 38376283	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	23095110		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	15888697	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	26498345, 26809128	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30872677		★☆☆☆☆ Found in Text Mining only
Reticulosarcoma	Reticulosarcoma	BEFREE	25494542		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	23393555, 28386366		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	27033599, 30186385		★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid tumor	Pubtator	23764045, 24913006	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	27488535, 30610105, 31113472, 31325529		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	28617441	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	21953341, 26152200		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis, Systemic Juvenile	Rheumatoid arthritis	GWASCAT_DG	27927641		★☆☆☆☆ Found in Text Mining only
Saethre-Chotzen Syndrome	Saethre-Chotzen Syndrome	BEFREE	28220539		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	25632070, 29162825, 30785874, 37527025	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	31380285, 31668005		★☆☆☆☆ Found in Text Mining only
Sarcoma Clear Cell	Sarcoma	Pubtator	37405123, 39567011	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	30785874	Inhibit	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	33495604	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma, Epithelioid	Sarcoma	BEFREE	26396249		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20471694, 25445625		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	20471694, 25445625		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	29907492, 30530989	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seminoma	Seminoma	BEFREE	21987446		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	36713456	Associate	★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	29458411		★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	18296916	Associate	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	18570928, 37725585	Associate	★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	28648462, 28879433, 31811660		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 2	Spinocerebellar Ataxia	BEFREE	28119557		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	21527555, 22629454, 23784969, 24394434		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30484863		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22748449, 23527004, 24278362, 34907286	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33649777	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	23784969		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	19742317, 21660961, 28790110, 30569244		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	27494404		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29154799		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30867763, 31365693, 31451695		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	11749695, 15569149, 19479822, 25146318, 26811494, 26831669, 31365693, 31672612, 31814524, 37537749, 37649598	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34232196	Stimulate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	22306652, 23449258, 23828597, 26347468, 27642596, 34727735, 36691064, 37324938	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
synovial sarcoma	Synovial sarcoma	BEFREE	28056055, 30785874		★☆☆☆☆ Found in Text Mining only
Systemic onset juvenile chronic arthritis	Arthritis	GWASCAT_DG	27927641		★☆☆☆☆ Found in Text Mining only
Systemic onset juvenile chronic arthritis	Arthritis	BEFREE	28331226		★☆☆☆☆ Found in Text Mining only
Tachycardia Ventricular	Ventricular tachycardia	Pubtator	27034410	Inhibit	★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	31315839		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	28838999		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	23940586, 26024393, 27172897	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	21806350		★☆☆☆☆ Found in Text Mining only
Thymic Carcinoma	Thymic Carcinoma	BEFREE	28486946		★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	19394967	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	30125607, 31395086		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	30125607, 31395086		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	19190121, 21367844, 22359623, 26698299, 26751190, 27600599	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	34272941	Stimulate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	22826467, 25503779, 26294743, 29113202, 29371976, 29936177, 30050079, 30334455, 31559416		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	23354309, 27859250, 31892549	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	29936177	Stimulate	★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	19767015		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	21507255, 24006305, 27082124, 31987970, 35239708, 36371227	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	28889393, 30064501		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	12504567, 17504382, 30896789	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25900886	Inhibit	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	31227503		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	35332245	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	23518467	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	27100479, 37573538	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	29520069, 30674723		★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	24456602	Associate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	20519629	Associate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	21454220		★☆☆☆☆ Found in Text Mining only