Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9722
Gene name	Nitric oxide synthase 1 adaptor protein
Gene symbol	NOS1AP
Synonyms (NCBI Gene)	6330408P19RikCAPONNPHS22
Chromosome	1
Chromosome location	1q23.3
Summary	This gene encodes a cytosolic protein that binds to the signaling molecule, neuronal nitric oxide synthase (nNOS). This protein has a C-terminal PDZ-binding domain that mediates interactions with nNOS and an N-terminal phosphotyrosine binding (PTB) domain

326

Show/Hide all (326)

miRTarBase ID	miRNA	Experiments	Reference
MIRT044525	hsa-miR-320a	CLASH	23622248
MIRT038020	hsa-miR-423-5p	CLASH	23622248
MIRT619425	hsa-miR-8485	HITS-CLIP	23824327
MIRT619424	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT619423	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT619422	hsa-miR-888-3p	HITS-CLIP	23824327
MIRT619421	hsa-miR-3622a-3p	HITS-CLIP	23824327
MIRT619420	hsa-miR-3622b-3p	HITS-CLIP	23824327
MIRT619419	hsa-miR-181a-2-3p	HITS-CLIP	23824327
MIRT619418	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT619417	hsa-miR-138-2-3p	HITS-CLIP	23824327
MIRT630343	hsa-miR-6730-3p	HITS-CLIP	23824327
MIRT619416	hsa-miR-3151-3p	HITS-CLIP	23824327
MIRT619415	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT619414	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT619413	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT619425	hsa-miR-8485	HITS-CLIP	23824327
MIRT619424	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT619423	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT619422	hsa-miR-888-3p	HITS-CLIP	23824327
MIRT619421	hsa-miR-3622a-3p	HITS-CLIP	23824327
MIRT619420	hsa-miR-3622b-3p	HITS-CLIP	23824327
MIRT619419	hsa-miR-181a-2-3p	HITS-CLIP	23824327
MIRT619418	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT619417	hsa-miR-138-2-3p	HITS-CLIP	23824327
MIRT630343	hsa-miR-6730-3p	HITS-CLIP	23824327
MIRT619416	hsa-miR-3151-3p	HITS-CLIP	23824327
MIRT619415	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT619414	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT619413	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT619425	hsa-miR-8485	HITS-CLIP	23824327
MIRT619424	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT619423	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT619422	hsa-miR-888-3p	HITS-CLIP	23824327
MIRT619421	hsa-miR-3622a-3p	HITS-CLIP	23824327
MIRT619420	hsa-miR-3622b-3p	HITS-CLIP	23824327
MIRT619419	hsa-miR-181a-2-3p	HITS-CLIP	23824327
MIRT619418	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT619417	hsa-miR-138-2-3p	HITS-CLIP	23824327
MIRT619416	hsa-miR-3151-3p	HITS-CLIP	23824327
MIRT619415	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT619414	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT619413	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT456651	hsa-miR-6768-5p	PAR-CLIP	23592263
MIRT456650	hsa-miR-1197	PAR-CLIP	23592263
MIRT456649	hsa-miR-4688	PAR-CLIP	23592263
MIRT456648	hsa-miR-6743-5p	PAR-CLIP	23592263
MIRT456647	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT038020	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT456646	hsa-miR-1914-3p	PAR-CLIP	23592263
MIRT456645	hsa-miR-5194	PAR-CLIP	23592263
MIRT456644	hsa-miR-6738-5p	PAR-CLIP	23592263
MIRT456643	hsa-miR-7854-3p	PAR-CLIP	23592263
MIRT456642	hsa-miR-3689d	PAR-CLIP	23592263
MIRT456641	hsa-miR-6851-5p	PAR-CLIP	23592263
MIRT456640	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT456639	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT456637	hsa-miR-4710	PAR-CLIP	23592263
MIRT456638	hsa-miR-7977	PAR-CLIP	23592263
MIRT456636	hsa-miR-6734-5p	PAR-CLIP	23592263
MIRT619425	hsa-miR-8485	HITS-CLIP	23824327
MIRT619424	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT619423	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT619422	hsa-miR-888-3p	HITS-CLIP	23824327
MIRT619421	hsa-miR-3622a-3p	HITS-CLIP	23824327
MIRT619420	hsa-miR-3622b-3p	HITS-CLIP	23824327
MIRT619419	hsa-miR-181a-2-3p	HITS-CLIP	23824327
MIRT619418	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT619417	hsa-miR-138-2-3p	HITS-CLIP	23824327
MIRT630343	hsa-miR-6730-3p	HITS-CLIP	23824327
MIRT619416	hsa-miR-3151-3p	HITS-CLIP	23824327
MIRT619415	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT619414	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT619413	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT619425	hsa-miR-8485	HITS-CLIP	23824327
MIRT619424	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT619423	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT619422	hsa-miR-888-3p	HITS-CLIP	23824327
MIRT619421	hsa-miR-3622a-3p	HITS-CLIP	23824327
MIRT619420	hsa-miR-3622b-3p	HITS-CLIP	23824327
MIRT619419	hsa-miR-181a-2-3p	HITS-CLIP	23824327
MIRT619418	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT619417	hsa-miR-138-2-3p	HITS-CLIP	23824327
MIRT630343	hsa-miR-6730-3p	HITS-CLIP	23824327
MIRT619416	hsa-miR-3151-3p	HITS-CLIP	23824327
MIRT619415	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT619414	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT619413	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT619425	hsa-miR-8485	HITS-CLIP	23824327
MIRT619424	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT619423	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT619422	hsa-miR-888-3p	HITS-CLIP	23824327
MIRT619421	hsa-miR-3622a-3p	HITS-CLIP	23824327
MIRT619420	hsa-miR-3622b-3p	HITS-CLIP	23824327
MIRT619419	hsa-miR-181a-2-3p	HITS-CLIP	23824327
MIRT619418	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT619417	hsa-miR-138-2-3p	HITS-CLIP	23824327
MIRT619416	hsa-miR-3151-3p	HITS-CLIP	23824327
MIRT619415	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT619414	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT619413	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT456651	hsa-miR-6768-5p	PAR-CLIP	23592263
MIRT456650	hsa-miR-1197	PAR-CLIP	23592263
MIRT456649	hsa-miR-4688	PAR-CLIP	23592263
MIRT456648	hsa-miR-6743-5p	PAR-CLIP	23592263
MIRT456647	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT038020	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT456646	hsa-miR-1914-3p	PAR-CLIP	23592263
MIRT456645	hsa-miR-5194	PAR-CLIP	23592263
MIRT456644	hsa-miR-6738-5p	PAR-CLIP	23592263
MIRT456643	hsa-miR-7854-3p	PAR-CLIP	23592263
MIRT456642	hsa-miR-3689d	PAR-CLIP	23592263
MIRT456641	hsa-miR-6851-5p	PAR-CLIP	23592263
MIRT456640	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT456639	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT456637	hsa-miR-4710	PAR-CLIP	23592263
MIRT456638	hsa-miR-7977	PAR-CLIP	23592263
MIRT456636	hsa-miR-6734-5p	PAR-CLIP	23592263
MIRT1189449	hsa-miR-106a	CLIP-seq
MIRT1189450	hsa-miR-106b	CLIP-seq
MIRT1189451	hsa-miR-1245b-5p	CLIP-seq
MIRT1189452	hsa-miR-125a-5p	CLIP-seq
MIRT1189453	hsa-miR-125b	CLIP-seq
MIRT1189454	hsa-miR-1299	CLIP-seq
MIRT1189455	hsa-miR-17	CLIP-seq
MIRT1189456	hsa-miR-20a	CLIP-seq
MIRT1189457	hsa-miR-20b	CLIP-seq
MIRT1189458	hsa-miR-21	CLIP-seq
MIRT1189459	hsa-miR-302a	CLIP-seq
MIRT1189460	hsa-miR-302b	CLIP-seq
MIRT1189461	hsa-miR-302c	CLIP-seq
MIRT1189462	hsa-miR-302d	CLIP-seq
MIRT1189463	hsa-miR-302e	CLIP-seq
MIRT1189464	hsa-miR-3122	CLIP-seq
MIRT1189465	hsa-miR-3142	CLIP-seq
MIRT1189466	hsa-miR-3202	CLIP-seq
MIRT1189467	hsa-miR-34a	CLIP-seq
MIRT1189468	hsa-miR-34c-5p	CLIP-seq
MIRT1189469	hsa-miR-3609	CLIP-seq
MIRT1189470	hsa-miR-362-5p	CLIP-seq
MIRT1189471	hsa-miR-3688-5p	CLIP-seq
MIRT1189472	hsa-miR-372	CLIP-seq
MIRT1189473	hsa-miR-373	CLIP-seq
MIRT1189474	hsa-miR-3913-5p	CLIP-seq
MIRT1189475	hsa-miR-3919	CLIP-seq
MIRT1189476	hsa-miR-3942-3p	CLIP-seq
MIRT1189477	hsa-miR-4281	CLIP-seq
MIRT1189478	hsa-miR-4319	CLIP-seq
MIRT1189479	hsa-miR-4488	CLIP-seq
MIRT1189480	hsa-miR-4493	CLIP-seq
MIRT1189481	hsa-miR-449a	CLIP-seq
MIRT1189482	hsa-miR-449b	CLIP-seq
MIRT1189483	hsa-miR-4504	CLIP-seq
MIRT1189484	hsa-miR-4505	CLIP-seq
MIRT1189485	hsa-miR-450b-3p	CLIP-seq
MIRT1189486	hsa-miR-4533	CLIP-seq
MIRT1189487	hsa-miR-4640-5p	CLIP-seq
MIRT1189488	hsa-miR-4687-3p	CLIP-seq
MIRT1189489	hsa-miR-4697-5p	CLIP-seq
MIRT1189490	hsa-miR-4726-5p	CLIP-seq
MIRT1189491	hsa-miR-4731-5p	CLIP-seq
MIRT1189492	hsa-miR-4732-3p	CLIP-seq
MIRT1189493	hsa-miR-4756-3p	CLIP-seq
MIRT1189494	hsa-miR-4777-3p	CLIP-seq
MIRT1189495	hsa-miR-4796-3p	CLIP-seq
MIRT1189496	hsa-miR-500b	CLIP-seq
MIRT1189497	hsa-miR-501-5p	CLIP-seq
MIRT1189498	hsa-miR-502-5p	CLIP-seq
MIRT1189499	hsa-miR-512-3p	CLIP-seq
MIRT1189500	hsa-miR-513b	CLIP-seq
MIRT1189501	hsa-miR-519d	CLIP-seq
MIRT1189502	hsa-miR-520a-3p	CLIP-seq
MIRT1189503	hsa-miR-520b	CLIP-seq
MIRT1189504	hsa-miR-520c-3p	CLIP-seq
MIRT1189505	hsa-miR-520d-3p	CLIP-seq
MIRT1189506	hsa-miR-520e	CLIP-seq
MIRT1189507	hsa-miR-542-3p	CLIP-seq
MIRT1189508	hsa-miR-548ah	CLIP-seq
MIRT1189509	hsa-miR-590-5p	CLIP-seq
MIRT1189510	hsa-miR-637	CLIP-seq
MIRT1189511	hsa-miR-642b	CLIP-seq
MIRT1189512	hsa-miR-670	CLIP-seq
MIRT1189513	hsa-miR-708	CLIP-seq
MIRT1189514	hsa-miR-760	CLIP-seq
MIRT1189515	hsa-miR-769-3p	CLIP-seq
MIRT1189516	hsa-miR-875-3p	CLIP-seq
MIRT1189517	hsa-miR-93	CLIP-seq
MIRT1189458	hsa-miR-21	CLIP-seq
MIRT1189518	hsa-miR-219-1-3p	CLIP-seq
MIRT1189519	hsa-miR-323b-3p	CLIP-seq
MIRT1189520	hsa-miR-33a	CLIP-seq
MIRT1189521	hsa-miR-33b	CLIP-seq
MIRT1189522	hsa-miR-4327	CLIP-seq
MIRT1189523	hsa-miR-4424	CLIP-seq
MIRT1189483	hsa-miR-4504	CLIP-seq
MIRT1189524	hsa-miR-451b	CLIP-seq
MIRT1189525	hsa-miR-4524	CLIP-seq
MIRT1189526	hsa-miR-4540	CLIP-seq
MIRT1189527	hsa-miR-4691-5p	CLIP-seq
MIRT1189528	hsa-miR-4731-3p	CLIP-seq
MIRT1189529	hsa-miR-4801	CLIP-seq
MIRT1189507	hsa-miR-542-3p	CLIP-seq
MIRT1189530	hsa-miR-554	CLIP-seq
MIRT1189509	hsa-miR-590-5p	CLIP-seq
MIRT1189511	hsa-miR-642b	CLIP-seq
MIRT1189449	hsa-miR-106a	CLIP-seq
MIRT1189450	hsa-miR-106b	CLIP-seq
MIRT1189531	hsa-miR-1178	CLIP-seq
MIRT1189532	hsa-miR-1207-3p	CLIP-seq
MIRT1189455	hsa-miR-17	CLIP-seq
MIRT1189533	hsa-miR-181a	CLIP-seq
MIRT1189534	hsa-miR-181b	CLIP-seq
MIRT1189535	hsa-miR-181c	CLIP-seq
MIRT1189536	hsa-miR-181d	CLIP-seq
MIRT1189537	hsa-miR-204	CLIP-seq
MIRT1189456	hsa-miR-20a	CLIP-seq
MIRT1189457	hsa-miR-20b	CLIP-seq
MIRT1189458	hsa-miR-21	CLIP-seq
MIRT1189538	hsa-miR-211	CLIP-seq
MIRT1189459	hsa-miR-302a	CLIP-seq
MIRT1189460	hsa-miR-302b	CLIP-seq
MIRT1189461	hsa-miR-302c	CLIP-seq
MIRT1189462	hsa-miR-302d	CLIP-seq
MIRT1189463	hsa-miR-302e	CLIP-seq
MIRT1189539	hsa-miR-3135b	CLIP-seq
MIRT1189540	hsa-miR-3175	CLIP-seq
MIRT1189541	hsa-miR-3184	CLIP-seq
MIRT1189542	hsa-miR-329	CLIP-seq
MIRT1189469	hsa-miR-3609	CLIP-seq
MIRT1189543	hsa-miR-3620	CLIP-seq
MIRT1189544	hsa-miR-3652	CLIP-seq
MIRT1189545	hsa-miR-3674	CLIP-seq
MIRT1189472	hsa-miR-372	CLIP-seq
MIRT1189473	hsa-miR-373	CLIP-seq
MIRT1189475	hsa-miR-3919	CLIP-seq
MIRT1189546	hsa-miR-3922-5p	CLIP-seq
MIRT1189476	hsa-miR-3942-3p	CLIP-seq
MIRT1189547	hsa-miR-4262	CLIP-seq
MIRT1189548	hsa-miR-4277	CLIP-seq
MIRT1189549	hsa-miR-4278	CLIP-seq
MIRT1189550	hsa-miR-4287	CLIP-seq
MIRT1189551	hsa-miR-4320	CLIP-seq
MIRT1189552	hsa-miR-4430	CLIP-seq
MIRT1189553	hsa-miR-4434	CLIP-seq
MIRT1189554	hsa-miR-4436a	CLIP-seq
MIRT1189555	hsa-miR-4476	CLIP-seq
MIRT1189483	hsa-miR-4504	CLIP-seq
MIRT1189556	hsa-miR-4514	CLIP-seq
MIRT1189557	hsa-miR-4516	CLIP-seq
MIRT1189558	hsa-miR-4520a-3p	CLIP-seq
MIRT1189559	hsa-miR-4531	CLIP-seq
MIRT1189560	hsa-miR-4638-3p	CLIP-seq
MIRT1189561	hsa-miR-4645-5p	CLIP-seq
MIRT1189562	hsa-miR-4673	CLIP-seq
MIRT1189563	hsa-miR-4680-3p	CLIP-seq
MIRT1189564	hsa-miR-4685-3p	CLIP-seq
MIRT1189565	hsa-miR-4692	CLIP-seq
MIRT1189566	hsa-miR-4693-3p	CLIP-seq
MIRT1189567	hsa-miR-4700-3p	CLIP-seq
MIRT1189568	hsa-miR-4716-3p	CLIP-seq
MIRT1189493	hsa-miR-4756-3p	CLIP-seq
MIRT1189495	hsa-miR-4796-3p	CLIP-seq
MIRT1189569	hsa-miR-4803	CLIP-seq
MIRT1189570	hsa-miR-483-5p	CLIP-seq
MIRT1189571	hsa-miR-501-3p	CLIP-seq
MIRT1189572	hsa-miR-502-3p	CLIP-seq
MIRT1189499	hsa-miR-512-3p	CLIP-seq
MIRT1189500	hsa-miR-513b	CLIP-seq
MIRT1189501	hsa-miR-519d	CLIP-seq
MIRT1189502	hsa-miR-520a-3p	CLIP-seq
MIRT1189503	hsa-miR-520b	CLIP-seq
MIRT1189504	hsa-miR-520c-3p	CLIP-seq
MIRT1189505	hsa-miR-520d-3p	CLIP-seq
MIRT1189506	hsa-miR-520e	CLIP-seq
MIRT1189507	hsa-miR-542-3p	CLIP-seq
MIRT1189573	hsa-miR-543	CLIP-seq
MIRT1189574	hsa-miR-548a-3p	CLIP-seq
MIRT1189508	hsa-miR-548ah	CLIP-seq
MIRT1189575	hsa-miR-548e	CLIP-seq
MIRT1189576	hsa-miR-548f	CLIP-seq
MIRT1189577	hsa-miR-566	CLIP-seq
MIRT1189509	hsa-miR-590-5p	CLIP-seq
MIRT1189511	hsa-miR-642b	CLIP-seq
MIRT1189513	hsa-miR-708	CLIP-seq
MIRT1189578	hsa-miR-767-5p	CLIP-seq
MIRT1189517	hsa-miR-93	CLIP-seq
MIRT1189579	hsa-miR-940	CLIP-seq
MIRT1189500	hsa-miR-513b	CLIP-seq
MIRT1189513	hsa-miR-708	CLIP-seq
MIRT1189500	hsa-miR-513b	CLIP-seq
MIRT1189513	hsa-miR-708	CLIP-seq
MIRT1922883	hsa-miR-338-3p	CLIP-seq
MIRT1922884	hsa-miR-4530	CLIP-seq
MIRT1189527	hsa-miR-4691-5p	CLIP-seq
MIRT1922885	hsa-miR-4736	CLIP-seq
MIRT1922886	hsa-miR-486-3p	CLIP-seq
MIRT1922887	hsa-miR-766	CLIP-seq
MIRT1189542	hsa-miR-329	CLIP-seq
MIRT2054837	hsa-miR-1269	CLIP-seq
MIRT2054838	hsa-miR-1269b	CLIP-seq
MIRT2054839	hsa-miR-4529-3p	CLIP-seq
MIRT1189542	hsa-miR-329	CLIP-seq
MIRT1189542	hsa-miR-329	CLIP-seq
MIRT1189467	hsa-miR-34a	CLIP-seq
MIRT1189468	hsa-miR-34c-5p	CLIP-seq
MIRT1189546	hsa-miR-3922-5p	CLIP-seq
MIRT2283904	hsa-miR-3941	CLIP-seq
MIRT1189481	hsa-miR-449a	CLIP-seq
MIRT1189482	hsa-miR-449b	CLIP-seq
MIRT2283905	hsa-miR-603	CLIP-seq
MIRT1189458	hsa-miR-21	CLIP-seq
MIRT1189543	hsa-miR-3620	CLIP-seq
MIRT1189555	hsa-miR-4476	CLIP-seq
MIRT1189483	hsa-miR-4504	CLIP-seq
MIRT1189569	hsa-miR-4803	CLIP-seq
MIRT1189571	hsa-miR-501-3p	CLIP-seq
MIRT1189572	hsa-miR-502-3p	CLIP-seq
MIRT1189500	hsa-miR-513b	CLIP-seq
MIRT1189507	hsa-miR-542-3p	CLIP-seq
MIRT1189509	hsa-miR-590-5p	CLIP-seq
MIRT1189511	hsa-miR-642b	CLIP-seq
MIRT1189513	hsa-miR-708	CLIP-seq
MIRT1189578	hsa-miR-767-5p	CLIP-seq
MIRT1189574	hsa-miR-548a-3p	CLIP-seq
MIRT1189575	hsa-miR-548e	CLIP-seq
MIRT1189576	hsa-miR-548f	CLIP-seq

Show/Hide all (41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002102	Component	Podosome	IEA
GO:0003062	Process	Regulation of heart rate by chemical signal	IMP	19247217
GO:0005515	Function	Protein binding	IPI	25416956, 25814554, 28514442, 33961781
GO:0005634	Component	Nucleus	ISS	24665357
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS	19800018
GO:0005829	Component	Cytosol	ISS	24665357
GO:0005901	Component	Caveola	IEA
GO:0005901	Component	Caveola	ISS	19800018
GO:0006809	Process	Nitric oxide biosynthetic process	ISS	18337493
GO:0030018	Component	Z disc	IEA
GO:0030018	Component	Z disc	ISS	19800018
GO:0030175	Component	Filopodium	IEA
GO:0030235	Function	Nitric-oxide synthase regulator activity	ISS	18337493
GO:0030315	Component	T-tubule	IEA
GO:0030315	Component	T-tubule	ISS	24665357
GO:0031965	Component	Nuclear membrane	ISS	24665357
GO:0033017	Component	Sarcoplasmic reticulum membrane	IEA
GO:0033017	Component	Sarcoplasmic reticulum membrane	ISS	19800018
GO:0035591	Function	Signaling adaptor activity	ISS	9459447
GO:0042383	Component	Sarcolemma	ISS	18337493
GO:0042995	Component	Cell projection	IEA
GO:0045428	Process	Regulation of nitric oxide biosynthetic process	NAS	20431962
GO:0048471	Component	Perinuclear region of cytoplasm	ISS	18337493
GO:0050998	Function	Nitric-oxide synthase binding	IBA
GO:0050998	Function	Nitric-oxide synthase binding	IEA
GO:0050998	Function	Nitric-oxide synthase binding	ISS	18337493
GO:0060307	Process	Regulation of ventricular cardiac muscle cell membrane repolarization	IMP	19247217
GO:0060307	Process	Regulation of ventricular cardiac muscle cell membrane repolarization	ISS	18337493
GO:0070161	Component	Anchoring junction	IEA
GO:0098901	Process	Regulation of cardiac muscle cell action potential	ISS	18337493
GO:0098901	Process	Regulation of cardiac muscle cell action potential	TAS	24665357
GO:0098974	Process	Postsynaptic actin cytoskeleton organization	IDA	26869880
GO:0098974	Process	Postsynaptic actin cytoskeleton organization	IEP	26869880
GO:0098974	Process	Postsynaptic actin cytoskeleton organization	IMP	26869880
GO:0098978	Component	Glutamatergic synapse	IDA	26869880
GO:0098978	Component	Glutamatergic synapse	IMP	26869880
GO:1901381	Process	Positive regulation of potassium ion transmembrane transport	ISS	18337493
GO:1902514	Process	Regulation of calcium ion transmembrane transport via high voltage-gated calcium channel	ISS	18337493
GO:1902514	Process	Regulation of calcium ion transmembrane transport via high voltage-gated calcium channel	TAS	24665357
GO:1905026	Process	Positive regulation of membrane repolarization during ventricular cardiac muscle cell action potential	ISS	18337493

MIM	HGNC	e!Ensembl
605551	16859	ENSG00000198929

O75052

Protein name

Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein (C-terminal PDZ ligand of neuronal nitric oxide synthase protein) (Nitric oxide synthase 1 adaptor protein)

Protein function

Adapter protein involved in neuronal nitric-oxide (NO) synthesis regulation via its association with nNOS/NOS1. The complex formed with NOS1 and synapsins is necessary for specific NO and synapsin functions at a presynaptic level. Mediates an in

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00640	PID	32 → 175	Phosphotyrosine interaction domain (PTB/PID)	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in kidney glomeruli podocytes. {ECO:0000269|PubMed:33523862}.

Sequence

MPSKTKYNLVDDGHDLRIPLHNEDAFQHGICFEAKYVGSLDVPRPNSRVEIVAAMRRIRY
EFKAKNIKKKKVSIMVSVDGVKVILKKKKKLLLLQKKEWTWDESKMLVMQDPIYRIFYVS
HDSQDLKIFSYIARDGASNIFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNA
DGQEDGESERNSNSSGDPGRQLTGAERASTATAEETDIDAVEVPLPGNDVLEFSRGVTDL
DAVGKEGGSHTGSKVSHPQEPMLTASPRMLLPSSSSKPPGLGTETPLSTHHQMQLLQQLL
QQQQQQTQVAVAQVHLLKDQLAAEAAARLEAQARVHQLLLQNKDMLQHISLLVKQVQELE
LKLSGQNAMGSQDSLLEITFRSGALPVLCDPTTPKPEDLHSPPLGAGLADFAHPAGSPLG
RRDCLVKLECFRFLPPEDTPPPAQGEALLGGLELIKFRESGIASEYESNTDESEERDSWS
QEELPRLLNVLQRQELGDGLDDEIAV

Sequence length

506

Interactions

View interactions

	KEGG
	Circadian entrainment

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Nephrotic syndrome, type 22	Pathogenic	rs1656826074, rs908210610	RCV001290108 RCV001290109	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Cardiac arrhythmia	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL LONG QT SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Long QT syndrome	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
NOS1AP-related disorder	Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ROMANO-WARD SYNDROME	—	Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (67)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arrhythmias Cardiac	Cardiac arrhythmias	Pubtator	19305409, 19822806, 20538168, 21685173, 22682551	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	19204306, 19943157, 23347024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriovenous Malformations, Cerebral	Cerebral arteriovenous malformation	BEFREE	27080431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	19204306, 19943157, 23347024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	20602773	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	20602773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	LHGDN	16146415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	16146415	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22179838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brugada Syndrome (disorder)	Brugada Syndrome	BEFREE	24504561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	27869735	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	23347024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	26600494	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30727847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	24418727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	28755516	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	27080431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital long QT syndrome	Congenital Long QT Syndrome	BEFREE	19822806, 22708720, 24096169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	24418727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	21685173, 23171141, 24418727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	21685173, 23171141, 24418727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	21685173	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	23171141	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	21685173, 23171141, 24418727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	23146198, 26384012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	19943157, 23658158, 28755516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	18235038, 19943157, 23228162	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	LHGDN	18766325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	19943157, 23658158, 28755516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	19111066, 19943157, 20305679, 20722683, 34772419	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	18235038, 19111066, 19937226, 19943157, 20305679, 20722683, 23018631, 24338736, 31473185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	28755516, 38258807	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	31473185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27869735, 31171914	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	31171914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	26332198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	26332198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	20305679, 34772419	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	27080431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Long qt syndrome	Pubtator	19305408, 19822806, 20538168, 22682551, 22912591, 23347024, 27988371, 28720088, 31398660, 32429735	Associate	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Long QT Syndrome	Long QT Syndrome	BEFREE	19822806, 20538168, 22682551, 28720088, 30878014		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Long QT Syndrome 1	Long QT Syndrome	BEFREE	30878014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22179838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	23146198, 26384012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	20602773, 25612209, 27237129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	28465168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	28671047	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27869735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	20602773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	23228162	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	23146198, 28465168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	28416970	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Romano-Ward Syndrome	Romano-Ward Syndrome	ORPHANET_DG	19822806, 20538168		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Romano-Ward syndrome	Romano-Ward Syndrome	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	15707951, 16202394, 16978587, 18077426, 18414510, 18430503, 18474209, 19077434, 19255043, 19451863, 20541371, 20602773, 20638248, 23658158, 24220657 View all (5 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	15707951, 16146415, 16202394, 18430503, 18474209, 19077434		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	16146415, 19255043, 20602773, 20638248, 32987141	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	20638248, 24220657		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASDB_DG	23212062		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Severe depression	Mental Depression	BEFREE	23146198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	22019493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	31473185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tachycardia Ventricular	Ventricular tachycardia	Pubtator	28827735	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tachycardia, Ventricular	Ventricular tachycardia	BEFREE	28827735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Torsades de Pointes	Torsades de Pointes	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	22682551		★★★★★ ★☆☆☆☆ Found in Text Mining only

NOS1AP (nitric oxide synthase 1 adaptor protein)