CD74 (CD74 molecule)

Gene

• Entrez ID: 972
• Gene name: CD74 molecule
• Gene symbol: CD74
• Synonyms (NCBI Gene): CLIP, DHLAG, HLADG, II, Ia-GAMMA, p33
• Chromosome: 5
• Chromosome location: 5q33.1
• Summary: The protein encoded by this gene associates with class II major histocompatibility complex (MHC) and is an important chaperone that regulates antigen presentation for immune response. It also serves as cell surface receptor for the cytokine macrophage mig

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT876158	hsa-miR-1182	CLIP-seq
MIRT876159	hsa-miR-1276	CLIP-seq
MIRT876160	hsa-miR-4269	CLIP-seq
MIRT876161	hsa-miR-4645-5p	CLIP-seq
MIRT876162	hsa-miR-4673	CLIP-seq
MIRT876163	hsa-miR-4733-3p	CLIP-seq
MIRT876164	hsa-miR-4755-3p	CLIP-seq
MIRT1546272	hsa-miR-1205	CLIP-seq
MIRT1546273	hsa-miR-2110	CLIP-seq
MIRT1546274	hsa-miR-24	CLIP-seq
MIRT1546275	hsa-miR-3121-3p	CLIP-seq
MIRT1546276	hsa-miR-3153	CLIP-seq
MIRT1546277	hsa-miR-3665	CLIP-seq
MIRT1546278	hsa-miR-4271	CLIP-seq
MIRT1546279	hsa-miR-4284	CLIP-seq
MIRT1546280	hsa-miR-4667-5p	CLIP-seq
MIRT1546281	hsa-miR-4693-3p	CLIP-seq
MIRT1546282	hsa-miR-4700-5p	CLIP-seq
MIRT1546283	hsa-miR-4725-3p	CLIP-seq
MIRT1546284	hsa-miR-4731-5p	CLIP-seq
MIRT1546285	hsa-miR-596	CLIP-seq
MIRT1546286	hsa-miR-657	CLIP-seq
MIRT876158	hsa-miR-1182	CLIP-seq
MIRT2196686	hsa-miR-3135b	CLIP-seq
MIRT2196687	hsa-miR-3175	CLIP-seq
MIRT2196688	hsa-miR-3652	CLIP-seq
MIRT2196689	hsa-miR-4430	CLIP-seq
MIRT876163	hsa-miR-4733-3p	CLIP-seq
MIRT2385778	hsa-let-7a	CLIP-seq
MIRT2385779	hsa-let-7b	CLIP-seq
MIRT2385780	hsa-let-7c	CLIP-seq
MIRT2385781	hsa-let-7d	CLIP-seq
MIRT2385782	hsa-let-7e	CLIP-seq
MIRT2385783	hsa-let-7f	CLIP-seq
MIRT2385784	hsa-let-7g	CLIP-seq
MIRT2385785	hsa-let-7i	CLIP-seq
MIRT876158	hsa-miR-1182	CLIP-seq
MIRT2385786	hsa-miR-1236	CLIP-seq
MIRT2385787	hsa-miR-1255a	CLIP-seq
MIRT2385788	hsa-miR-1255b	CLIP-seq
MIRT2385789	hsa-miR-1273f	CLIP-seq
MIRT2385790	hsa-miR-202	CLIP-seq
MIRT1546273	hsa-miR-2110	CLIP-seq
MIRT2385791	hsa-miR-3150a-3p	CLIP-seq
MIRT1546276	hsa-miR-3153	CLIP-seq
MIRT2196687	hsa-miR-3175	CLIP-seq
MIRT2385792	hsa-miR-3189-3p	CLIP-seq
MIRT1546278	hsa-miR-4271	CLIP-seq
MIRT2385793	hsa-miR-4458	CLIP-seq
MIRT2385794	hsa-miR-4500	CLIP-seq
MIRT1546280	hsa-miR-4667-5p	CLIP-seq
MIRT1546282	hsa-miR-4700-5p	CLIP-seq
MIRT1546283	hsa-miR-4725-3p	CLIP-seq
MIRT1546284	hsa-miR-4731-5p	CLIP-seq
MIRT876163	hsa-miR-4733-3p	CLIP-seq
MIRT2385795	hsa-miR-4765	CLIP-seq
MIRT2385796	hsa-miR-502-5p	CLIP-seq
MIRT2385797	hsa-miR-760	CLIP-seq
MIRT2385798	hsa-miR-939	CLIP-seq
MIRT2385799	hsa-miR-98	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Unknown	8164652
RELA	Unknown	8164652

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0001516	Process	Prostaglandin biosynthetic process	IDA	12782713
GO:0001540	Function	Amyloid-beta binding	IPI	19849849
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	24942581
GO:0001961	Process	Positive regulation of cytokine-mediated signaling pathway	IBA
GO:0001961	Process	Positive regulation of cytokine-mediated signaling pathway	IEA
GO:0001961	Process	Positive regulation of cytokine-mediated signaling pathway	IMP	12782713
GO:0002250	Process	Adaptive immune response	IEA
GO:0002286	Process	T cell activation involved in immune response	IBA
GO:0002376	Process	Immune system process	IEA
GO:0002606	Process	Positive regulation of dendritic cell antigen processing and presentation	IEA
GO:0002792	Process	Negative regulation of peptide secretion	IDA	19849849
GO:0002830	Process	Positive regulation of type 2 immune response	IBA
GO:0002830	Process	Positive regulation of type 2 immune response	IEA
GO:0002906	Process	Negative regulation of mature B cell apoptotic process	IEA
GO:0004896	Function	Cytokine receptor activity	IBA
GO:0004896	Function	Cytokine receptor activity	IDA	17045821
GO:0004896	Function	Cytokine receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	17357109, 17435771, 19665027, 29190904, 30833792, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005634	Component	Nucleus	IDA	19423618
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	22952837, 24569872
GO:0005764	Component	Lysosome	IEA
GO:0005764	Component	Lysosome	ISS
GO:0005765	Component	Lysosomal membrane	TAS
GO:0005768	Component	Endosome	IEA
GO:0005770	Component	Late endosome	IEA
GO:0005770	Component	Late endosome	ISS
GO:0005771	Component	Multivesicular body	IEA
GO:0005773	Component	Vacuole	IDA	19849849
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IDA	19665027, 22952837, 24569872
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006457	Process	Protein folding	IEA
GO:0006886	Process	Intracellular protein transport	IEA
GO:0006886	Process	Intracellular protein transport	IEA
GO:0006886	Process	Intracellular protein transport	ISS
GO:0006952	Process	Defense response	IEA
GO:0006955	Process	Immune response	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IDA	17045821, 19665027, 22952837
GO:0010628	Process	Positive regulation of gene expression	IMP	19423618
GO:0012507	Component	ER to Golgi transport vesicle membrane	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IDA	12782713
GO:0016020	Component	Membrane	IEA
GO:0016064	Process	Immunoglobulin mediated immune response	IEA
GO:0016064	Process	Immunoglobulin mediated immune response	ISS
GO:0019882	Process	Antigen processing and presentation	IBA
GO:0019882	Process	Antigen processing and presentation	IEA
GO:0019882	Process	Antigen processing and presentation	IEA
GO:0019883	Process	Antigen processing and presentation of endogenous antigen	NAS	10981873
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IEA
GO:0019955	Function	Cytokine binding	IEA
GO:0019955	Function	Cytokine binding	IPI	17567581
GO:0023026	Function	MHC class II protein complex binding	IDA	1448172
GO:0030336	Process	Negative regulation of cell migration	IMP	20198449, 22952837
GO:0030658	Component	Transport vesicle membrane	TAS
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0030890	Process	Positive regulation of B cell proliferation	IMP	12782713
GO:0031394	Process	Positive regulation of prostaglandin biosynthetic process	IMP	24569872
GO:0032588	Component	Trans-Golgi network membrane	TAS
GO:0032722	Process	Positive regulation of chemokine production	IMP	19423618
GO:0032755	Process	Positive regulation of interleukin-6 production	IMP	24569872
GO:0032757	Process	Positive regulation of interleukin-8 production	IMP	24569872
GO:0032991	Component	Protein-containing complex	IDA	19665027
GO:0033674	Process	Positive regulation of kinase activity	IDA	24942581
GO:0034341	Process	Response to type II interferon	IDA	32855215
GO:0034341	Process	Response to type II interferon	IEA
GO:0035691	Process	Macrophage migration inhibitory factor signaling pathway	IEA
GO:0035692	Component	Macrophage migration inhibitory factor receptor complex	IDA	17045821
GO:0035692	Component	Macrophage migration inhibitory factor receptor complex	IEA
GO:0035693	Component	NOS2-CD74 complex	IEA
GO:0035718	Function	Macrophage migration inhibitory factor binding	IBA
GO:0035718	Function	Macrophage migration inhibitory factor binding	IEA
GO:0035718	Function	Macrophage migration inhibitory factor binding	IPI	17045821
GO:0042289	Function	MHC class II protein binding	IBA
GO:0042289	Function	MHC class II protein binding	IEA
GO:0042289	Function	MHC class II protein binding	ISS
GO:0042289	Function	MHC class II protein binding	NAS	10981873
GO:0042609	Function	CD4 receptor binding	IPI	24942581
GO:0042613	Component	MHC class II protein complex	IEA
GO:0042613	Component	MHC class II protein complex	ISS
GO:0042658	Function	MHC class II protein binding, via antigen binding groove	IDA	7477400
GO:0042802	Function	Identical protein binding	TAS	12782713
GO:0043030	Process	Regulation of macrophage activation	NAS	12782713
GO:0043066	Process	Negative regulation of apoptotic process	IDA	12782713
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	24942581
GO:0043202	Component	Lysosomal lumen	TAS
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	24942581
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043518	Process	Negative regulation of DNA damage response, signal transduction by p53 class mediator	IBA
GO:0043518	Process	Negative regulation of DNA damage response, signal transduction by p53 class mediator	IDA	17045821
GO:0043518	Process	Negative regulation of DNA damage response, signal transduction by p53 class mediator	IEA
GO:0044183	Function	Protein folding chaperone	IDA	7477400
GO:0045058	Process	T cell selection	NAS	10981873
GO:0045059	Process	Positive thymic T cell selection	IEA
GO:0045060	Process	Negative thymic T cell selection	IEA
GO:0045581	Process	Negative regulation of T cell differentiation	IEA
GO:0045582	Process	Positive regulation of T cell differentiation	IEA
GO:0045657	Process	Positive regulation of monocyte differentiation	IDA	24942581
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	24942581
GO:0046597	Process	Host-mediated suppression of symbiont invasion	IDA	32855215
GO:0046598	Process	Positive regulation of viral entry into host cell	IDA	24942581
GO:0048146	Process	Positive regulation of fibroblast proliferation	IMP	12782713
GO:0050821	Process	Protein stabilization	ISS
GO:0050998	Function	Nitric-oxide synthase binding	IEA
GO:0060907	Process	Positive regulation of macrophage cytokine production	IBA
GO:0060907	Process	Positive regulation of macrophage cytokine production	IEA
GO:0060907	Process	Positive regulation of macrophage cytokine production	ISS
GO:0065003	Process	Protein-containing complex assembly	IEA
GO:0065003	Process	Protein-containing complex assembly	ISS
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070206	Process	Protein trimerization	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IBA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	17045821, 24942581
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	12782713
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	IEA
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	ISS
GO:0098553	Component	Lumenal side of endoplasmic reticulum membrane	TAS
GO:1902166	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IBA
GO:1902166	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IEA
GO:1902166	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IMP	17045821
GO:2000343	Process	Positive regulation of chemokine (C-X-C motif) ligand 2 production	IEA
GO:2000343	Process	Positive regulation of chemokine (C-X-C motif) ligand 2 production	ISS
GO:2000448	Process	Positive regulation of macrophage migration inhibitory factor signaling pathway	IMP	19665027

Other IDs

• MIM: 142790
• HGNC: 1697
• e!Ensembl: ENSG00000019582

Protein

• UniProt ID: P04233
• Protein name: HLA class II histocompatibility antigen gamma chain (HLA-DR antigens-associated invariant chain) (Ia antigen-associated invariant chain) (Ii) (CD antigen CD74) [Cleaved into: Class-II-associated invariant chain peptide (CLIP)]
• Protein function: Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to the endosomal/
• PDB: 1A6A, 1ICF, 1IIE, 1L3H, 1MUJ, 3PDO, 3PGC, 3PGD, 3QXA, 3QXD, 4AEN, 4AH2, 4X5W, 5KSU, 5KSV, 7YX9, 7YXB, 7Z0Q, 8VRW, 8VSJ, 8VSP, 9CYL, 9CYM
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF09307	MHC2-interact	17 → 129	CLIP, MHC2 interacting	Domain
  PF08831	MHCassoc_trimer	136 → 204	Class II MHC-associated invariant chain trimerisation domain	Domain
  PF00086	Thyroglobulin_1	208 → 271	Thyroglobulin type-1 repeat	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in urine (at protein level). {ECO:0000269|PubMed:25326458, ECO:0000269|PubMed:36213313, ECO:0000269|PubMed:37453717}.; TISSUE SPECIFICITY: [Isoform p41]: In B cells, represents 10% of total CD74 expression. {ECO:0000269|PubMed
• Sequence:

  MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLL
  LAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPM
  GALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKV
  FESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLP
  LQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM

• Sequence length: 296

Pathways

KEGG:

Antigen processing and presentation
Tuberculosis
Herpes simplex virus 1 infection

Reactome:

Cell surface interactions at the vascular wall
MHC class II antigen presentation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER FAILURE, ACUTE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
5q-syndrome	5q-syndrome	BEFREE	20733155, 22571696		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	31105032		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	24469108, 29858224, 31382039		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	19269807		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	19269807		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	33081847	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	31234498		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	20443131		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	29490705		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	37175670	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	19423618		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	23896945, 26524976		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	29848367	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	19423618		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	37508563	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	23913513		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28219888, 29669180		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	17686984, 19245431		★☆☆☆☆ Found in Text Mining only
Bile Duct Diseases	Bile duct disease	Pubtator	40596471	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29731899		★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	25565391	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	27157615		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	29490700, 34209696	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15365563, 26403072, 27058619, 27626171, 27834468, 29099283, 29190904		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	19602265		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22935920, 23730214, 24939415, 27058619, 27626171, 29099283, 32305991	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	33235138	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24939415, 27626171, 35208514, 35769782, 37880655	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15365563, 22905972		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	28114961	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34009409	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	27247112	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	29731899		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22659450, 24469108, 26837769		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	37629174, 37653101	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	30838877	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21792010	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	35208514	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	19423618		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	31611368	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	19423618		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	27884769	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	27884769		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	17686984, 19245431, 20357260, 3128976		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	24441872		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	21228923	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	21228923, 32521887	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21228923, 28114961, 39824178	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	18941249, 23273913, 30838877		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	10463820		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	37818353	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	25172501		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	18842989	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	23637351, 37576973	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18842989, 36527108	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	29095944		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	18842989	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	18842989		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	24974304		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	26500140		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	25439837	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	33159014	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	29592775		★☆☆☆☆ Found in Text Mining only
Enthesitis	Enthesitis	BEFREE	29490705		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	10981873		★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	39394558	Associate	★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	15365563		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	27752708		★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	25600560		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	21228923	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	20443131, 25175718		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	25175718	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	20443131		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25175718		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25175718	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	21106847, 31017008		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	33754492	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	38169915	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	22905972, 25304249		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	25175718	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	30191677	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	15475450, 27752708, 29601965		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	25172501		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	22952837	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	24569872		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	27884769		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	39616313	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30077612, 30968541		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	LHGDN	18941249		★☆☆☆☆ Found in Text Mining only
Leprosy Lepromatous	Leprosy	Pubtator	29487601	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	26246143, 29286103, 31105032, 38299667	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	26246143, 31105032		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	15688398		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	23913513	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	40596471	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	CTD_human_DG	16799971		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases Interstitial	Lung disease	Pubtator	25052332	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	19131591		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	24469108		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24759083, 26837769, 32852072	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	29070082, 39290707	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	20738420, 28219888		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	28219888		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22611320	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22935920, 32521887	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	15475450, 16109781, 25304249		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	30191677	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	28079637		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	22042694		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15365563, 26403072, 27058619, 27626171, 29099283, 29190904		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	19602265		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	30914802		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22659450, 24469108, 26837769		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	16638847		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22611320, 27323782		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	25600560		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29731899		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15475450, 18941249, 23730214, 25351743, 26783288, 26837769, 29428527, 29601965, 29669180, 29731899, 30914802		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	19602265		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	17560571, 23730214, 29190904		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	19602265		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	19602265		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	22042694, 25937048		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	14755246, 26039541, 26783288, 31069878		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	26783288, 31069878, 33344042	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	36466837	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	37880655	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	24594996, 26883190		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	24594996, 37147569	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	20504837		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	29875777		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	21228923	Associate	★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	39290707	Associate	★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	24469108, 24913807, 26837769		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	28707750	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	15475450, 30701025		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	15475450		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	30191677, 35145037, 38035078	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	30160778	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	30353480		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndrome with Isolated del(5q)	Myelodysplastic syndrome	BEFREE	20733155, 22571696		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	23896945		★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	32259312, 37153570	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10981873, 12835293, 22905972, 23273913, 23427296, 23679566, 23730214, 25157770, 2555151, 25600560, 26039541, 26412712, 26783288, 26883190, 27058619, 27157615, 27834468, 29045509, 29490700, 31027511, 31215104, 31817155		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	35173708	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22215748, 22659450, 23877438, 24220096, 30885345		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	22919003		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29773671		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30737274		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29045509		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	29045509, 38256356	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	15467430	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	16638847		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	15477757, 21228923, 37629174	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	23679566	Stimulate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	25600560		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	30737274		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	23913513		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17142775		★☆☆☆☆ Found in Text Mining only
Protanomaly	Protanomaly	BEFREE	29490705		★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	24441872		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	18941249		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	18941249		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	18997086		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	31648555		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	31140396		★☆☆☆☆ Found in Text Mining only
Sacroiliitis	Sacroiliitis	BEFREE	29490705		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	30963193	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sepsis	Sepsis	Pubtator	39616313	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28477143, 28862321		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	29070082, 37153570	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	29487601		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	31692299		★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	29490705, 30723468, 31140396		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	32198923	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24663824		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19602232	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22611320, 27323782		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22611320, 27323782	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	38319150	Stimulate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	27884769	Associate	★☆☆☆☆ Found in Text Mining only
Systemic onset juvenile chronic arthritis	Arthritis	BEFREE	29848367		★☆☆☆☆ Found in Text Mining only
Thymic Carcinoma	Thymic Carcinoma	BEFREE	10981873		★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	10981873		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	26206776	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	25600560		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	25600560		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	26206776	Associate	★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	28487994		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	28487994		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	22935920, 37963845	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	11181568		★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	22905972		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	35208514	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	28639897	Associate	★☆☆☆☆ Found in Text Mining only