ST18 (ST18 C2H2C-type zinc finger transcription factor)

Gene

• Entrez ID: 9705
• Gene name: ST18 C2H2C-type zinc finger transcription factor
• Gene symbol: ST18
• Synonyms (NCBI Gene): NZF-3, NZF3, ZC2H2C3, ZC2HC10, ZNF387
• Chromosome: 8
• Chromosome location: 8q11.23

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT030273	hsa-miR-26b-5p	Microarray	19088304
MIRT447457	hsa-miR-451b	PAR-CLIP	22100165
MIRT447456	hsa-miR-580-3p	PAR-CLIP	22100165
MIRT447457	hsa-miR-451b	PAR-CLIP	22100165
MIRT447456	hsa-miR-580-3p	PAR-CLIP	22100165
MIRT447457	hsa-miR-451b	PAR-CLIP	22100165
MIRT447456	hsa-miR-580-3p	PAR-CLIP	22100165
MIRT447457	hsa-miR-451b	PAR-CLIP	22100165
MIRT447456	hsa-miR-580-3p	PAR-CLIP	22100165
MIRT1393215	hsa-miR-1207-3p	CLIP-seq
MIRT1393216	hsa-miR-1301	CLIP-seq
MIRT1393217	hsa-miR-1973	CLIP-seq
MIRT1393218	hsa-miR-2110	CLIP-seq
MIRT1393219	hsa-miR-3074-3p	CLIP-seq
MIRT1393220	hsa-miR-3667-3p	CLIP-seq
MIRT1393221	hsa-miR-3944-5p	CLIP-seq
MIRT1393222	hsa-miR-4271	CLIP-seq
MIRT1393223	hsa-miR-4660	CLIP-seq
MIRT1393224	hsa-miR-4667-5p	CLIP-seq
MIRT1393225	hsa-miR-4668-5p	CLIP-seq
MIRT1393226	hsa-miR-4700-5p	CLIP-seq
MIRT1393227	hsa-miR-4725-3p	CLIP-seq
MIRT1393228	hsa-miR-4731-5p	CLIP-seq
MIRT1393229	hsa-miR-495	CLIP-seq
MIRT1393230	hsa-miR-5047	CLIP-seq
MIRT2118073	hsa-miR-3180-5p	CLIP-seq
MIRT2118074	hsa-miR-4303	CLIP-seq
MIRT2118075	hsa-miR-4468	CLIP-seq
MIRT2118076	hsa-miR-4687-3p	CLIP-seq
MIRT2118077	hsa-miR-4690-5p	CLIP-seq
MIRT2339982	hsa-miR-2113	CLIP-seq
MIRT2339983	hsa-miR-4698	CLIP-seq
MIRT2339984	hsa-miR-579	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	18676404
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	15489893
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	15489893
GO:0010468	Process	Regulation of gene expression	IBA
GO:0032993	Component	Protein-DNA complex	IDA	18676404
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IMP	18676404
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	18676404
GO:0046872	Function	Metal ion binding	IEA
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IMP	18676404
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IMP	18676404

Other IDs

• MIM: 617155
• HGNC: 18695
• e!Ensembl: ENSG00000147488

Protein

• UniProt ID: O60284
• Protein name: Suppression of tumorigenicity 18 protein (Zinc finger protein 387)
• Protein function: Repressor that binds to DNA sequences containing a bipartite element consisting of a direct repeat of the sequence 5'-AAAGTTT-3' separated by 2-9 nucleotides. Represses basal transcription activity from target promoters (By similarity). Inhibits
• PDB: 2CS8
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01530	zf-C2HC	367 → 394	Zinc finger, C2HC type	Family
  PF01530	zf-C2HC	411 → 439	Zinc finger, C2HC type	Family
  PF08474	MYT1	478 → 715	Myelin transcription factor 1	Family
  PF01530	zf-C2HC	723 → 751	Zinc finger, C2HC type	Family
  PF01530	zf-C2HC	767 → 795	Zinc finger, C2HC type	Family
  PF01530	zf-C2HC	815 → 843	Zinc finger, C2HC type	Family
  PF01530	zf-C2HC	868 → 896	Zinc finger, C2HC type	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected at low levels in heart, liver, kidney, skeletal muscle, pancreas, testis, ovary and prostate. Detected at even lower levels in mammary epithelial cells and breast cancer cells. {ECO:0000269|PubMed:15489893}.
• Sequence:

  MDAEAEDKTLRTRSKGTEVPMDSLIQELSVAYDCSMAKKRTAEDQALGVPVNKRKSLLMK
  PRHYSPKADCQEDRSDRTEDDGPLETHGHSTAEEIMIKPMDESLLSTAQENSSRKEDRYS
  CYQELMVKSLMHLGKFEKNVSVQTVSENLNDSGIQSLKAESDEADECFLIHSDDGRDKID
  DSQPPFCSSDDNESNSESAENGWDSGSNFSEETKPPRVPKYVLTDHKKDLLEVPEIKTEG
  DKFIPCENRCDSETERKDPQNALAEPLDGNAQPSFPDVEEEDSESLAVMTEEGSDLEKAK
  GNLSLLEQAIALQAERGCVFHNTYKELDRFLLEHLAGERRQTKVIDMGGRQIFNNKHSPR
  PEKRETKCPIPGCDGTGHVTGLYPHHRSLSGCPHKVRVPLEILAMHENVLKCPTPGCTGR
  GHVNSNRNTHRSLSGCPIAAAEKLAMSQDKNQLDSPQTGQCPDQAHRTSLVKQIEFNFPS
  QAITSPRATVSKEQEKFGKVPFDYASFDAQVFGKRPLIQTVQGRKTPPFPESKHFPNPVK
  FPNRLPSAGAHTQSPGRASSYSYGQCSEDTHIAAAAAILNLSTRCREATDILSNKPQSLH
  AKGAEIEVDENGTLDLSMKKNRILDKSAPLTSSNTSIPTPSSSPFKTSSILVNAAFYQAL
  CDQEGWDTPINYSKTHGKTEEEKEKDPVSSLENLEEKKFPGEASIPSPKPKLHARDLKKE
  LITCPTPGCDGSGHVTGNYASHRSVSGCPLADKTLKSLMAANSQELKCPTPGCDGSGHVT
  GNYASHRSLSGCPRARKGGVKMTPTKEEKEDPELKCPVIGCDGQGHISGKYTSHRTASGC
  PLAAKRQKENPLNGASLSWKLNKQELPHCPLPGCNGLGHVNNVFVTHRSLSGCPLNAQVI
  KKGKVSEELMTIKLKATGGIESDEEIRHLDEEIKELNESNLKIEADMMKLQTQITSMESN
  LKTIEEENKLIEQNNESLLKELAGLSQALISSLADIQLPQMGPISEQNFEAYVNTLTDMY
  SNLERDYSPECKALLESIKQAVKGIHV

• Sequence length: 1047

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FRONTOTEMPORAL DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENERALIZED ANXIETY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	21151896		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	33640202	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	25380588		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASDB_DG	23535033		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	23535033		★☆☆☆☆ Found in Text Mining only
Angle Closure Glaucoma	Angle Closure Glaucoma	BEFREE	23505305, 23847314, 23920366, 24474268, 26497787, 26854036, 27064256, 31377279		★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	33640202	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15489893, 18676404, 30312684		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18676404	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33879706	Associate	★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	GWASCAT_DG	29724592		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	23505305, 23847314	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30312684		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30312684		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	36010616	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	35836279	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	34600138	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	34600138, 34619772	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23540693		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15489893, 18676404, 30312684		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15489893		★☆☆☆☆ Found in Text Mining only
Motion Sickness	Motion Sickness	GWASCAT_DG	25628336		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15489893, 24509857		★☆☆☆☆ Found in Text Mining only
Paratuberculosis	Paratuberculosis	BEFREE	2574186		★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	22437316, 27148741, 31057535, 35396567	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	BEFREE	30192416		★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	35396567	Stimulate	★☆☆☆☆ Found in Text Mining only
Pemphigus Vulgaris	Pemphigus Vulgaris	BEFREE	22437316, 27148741, 30926339, 31057535, 31342641		★☆☆☆☆ Found in Text Mining only
Primary angle-closure glaucoma	Angle closure glaucoma	BEFREE	23505305, 23847314, 23920366, 24474268, 26497787, 26854036, 27064256, 31377279		★☆☆☆☆ Found in Text Mining only