Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	9704
Gene name	DExH-box helicase 34
Gene symbol	DHX34
Synonyms (NCBI Gene)	DDX34HRH1
Chromosome	19
Chromosome location	19q13.32
Summary	DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and m

Show/Hide all (3)

SNP ID	Visualize variation	Clinical significance	Consequence
rs549149043	A>G	Likely-pathogenic	Missense variant, coding sequence variant, non coding transcript variant, 5 prime UTR variant
rs764483792	G>A,C,T	Likely-pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs1599751192	C>T	Likely-pathogenic	Non coding transcript variant, coding sequence variant, stop gained, 5 prime UTR variant

Show/Hide all (66)

miRTarBase ID	miRNA	Experiments	Reference
MIRT036237	hsa-miR-320b	CLASH	23622248
MIRT935506	hsa-miR-1207-3p	CLIP-seq
MIRT935507	hsa-miR-3130-3p	CLIP-seq
MIRT935508	hsa-miR-3177-3p	CLIP-seq
MIRT935509	hsa-miR-335	CLIP-seq
MIRT935510	hsa-miR-3689d	CLIP-seq
MIRT935511	hsa-miR-4436b-3p	CLIP-seq
MIRT935512	hsa-miR-4511	CLIP-seq
MIRT935513	hsa-miR-4639-5p	CLIP-seq
MIRT935514	hsa-miR-4736	CLIP-seq
MIRT935515	hsa-miR-516b	CLIP-seq
MIRT935516	hsa-miR-541	CLIP-seq
MIRT935517	hsa-miR-548b-3p	CLIP-seq
MIRT935518	hsa-miR-604	CLIP-seq
MIRT935519	hsa-miR-619	CLIP-seq
MIRT935520	hsa-miR-654-5p	CLIP-seq
MIRT935521	hsa-miR-658	CLIP-seq
MIRT1976935	hsa-miR-1185	CLIP-seq
MIRT1976936	hsa-miR-1302	CLIP-seq
MIRT1976937	hsa-miR-140-3p	CLIP-seq
MIRT1976938	hsa-miR-185	CLIP-seq
MIRT1976939	hsa-miR-2392	CLIP-seq
MIRT935507	hsa-miR-3130-3p	CLIP-seq
MIRT935509	hsa-miR-335	CLIP-seq
MIRT1976940	hsa-miR-3605-5p	CLIP-seq
MIRT1976941	hsa-miR-3679-5p	CLIP-seq
MIRT1976942	hsa-miR-3936	CLIP-seq
MIRT1976943	hsa-miR-4298	CLIP-seq
MIRT1976944	hsa-miR-4306	CLIP-seq
MIRT1976945	hsa-miR-4499	CLIP-seq
MIRT1976946	hsa-miR-4644	CLIP-seq
MIRT1976947	hsa-miR-4700-3p	CLIP-seq
MIRT1976948	hsa-miR-4793-3p	CLIP-seq
MIRT2212277	hsa-miR-1184	CLIP-seq
MIRT2212278	hsa-miR-1343	CLIP-seq
MIRT2212279	hsa-miR-1587	CLIP-seq
MIRT2212280	hsa-miR-3065-3p	CLIP-seq
MIRT2212281	hsa-miR-3135b	CLIP-seq
MIRT2212282	hsa-miR-3616-3p	CLIP-seq
MIRT2212283	hsa-miR-3620	CLIP-seq
MIRT2212284	hsa-miR-3652	CLIP-seq
MIRT2212285	hsa-miR-378g	CLIP-seq
MIRT2212286	hsa-miR-4269	CLIP-seq
MIRT2212287	hsa-miR-4430	CLIP-seq
MIRT935511	hsa-miR-4436b-3p	CLIP-seq
MIRT2212288	hsa-miR-4492	CLIP-seq
MIRT2212289	hsa-miR-4498	CLIP-seq
MIRT2212290	hsa-miR-4514	CLIP-seq
MIRT2212291	hsa-miR-4540	CLIP-seq
MIRT2212292	hsa-miR-4656	CLIP-seq
MIRT2212293	hsa-miR-4675	CLIP-seq
MIRT2212294	hsa-miR-4692	CLIP-seq
MIRT935514	hsa-miR-4736	CLIP-seq
MIRT2212295	hsa-miR-4741	CLIP-seq
MIRT2212296	hsa-miR-4742-5p	CLIP-seq
MIRT2212297	hsa-miR-554	CLIP-seq
MIRT2212298	hsa-miR-762	CLIP-seq
MIRT2386892	hsa-miR-1973	CLIP-seq
MIRT935507	hsa-miR-3130-3p	CLIP-seq
MIRT2386893	hsa-miR-4645-5p	CLIP-seq
MIRT2386894	hsa-miR-4673	CLIP-seq
MIRT1976948	hsa-miR-4793-3p	CLIP-seq
MIRT1976936	hsa-miR-1302	CLIP-seq
MIRT1976937	hsa-miR-140-3p	CLIP-seq
MIRT1976943	hsa-miR-4298	CLIP-seq
MIRT1976947	hsa-miR-4700-3p	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000184	Process	Nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	IBA
GO:0000956	Process	Nuclear-transcribed mRNA catabolic process	IMP	23828042
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22681889
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IEA
GO:0003724	Function	RNA helicase activity	IEA
GO:0004386	Function	Helicase activity	IBA
GO:0004386	Function	Helicase activity	IEA
GO:0005515	Function	Protein binding	IPI	25220460, 26841701, 33205750, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016787	Function	Hydrolase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IMP	33205750
GO:0042327	Process	Positive regulation of phosphorylation	IMP	26841701
GO:0044877	Function	Protein-containing complex binding	IPI	26841701
GO:2000623	Process	Negative regulation of nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	IMP	23828042

MIM	HGNC	e!Ensembl
615475	16719	ENSG00000134815

Q14147

Protein name

Probable ATP-dependent RNA helicase DHX34 (EC 3.6.4.13) (DEAH box protein 34) (DExH-box helicase 34)

Protein function

Probable ATP-binding RNA helicase required for nonsense-mediated decay (NMD) degradation of mRNA transcripts containing premature stop codons (PubMed:25220460, PubMed:33205750). Promotes the phosphorylation of UPF1 along with its interaction wit

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00271	Helicase_C	363 → 496	Helicase conserved C-terminal domain	Family
PF04408	HA2	557 → 747	Helicase associated domain (HA2)	Domain
PF07717	OB_NTP_bind	800 → 911	Oligonucleotide/oligosaccharide-binding (OB)-fold	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in whole blood, testis and spleen. Also expressed in the brain. {ECO:0000269|PubMed:31256877}.

Sequence

MPPPRTREGRDRRDHHRAPSEEEALEKWDWNCPETRRLLEDAFFREEDYIRQGSEECQKF
WTFFERLQRFQNLKTSRKEEKDPGQPKHSIPALADLPRTYDPRYRINLSVLGPATRGSQG
LGRHLPAERVAEFRRALLHYLDFGQKQAFGRLAKLQRERAALPIAQYGNRILQTLKEHQV
VVVAGDTGCGKSTQVPQYLLAAGFSHVACTQPRRIACISLAKRVGFESLSQYGSQVGYQI
RFESTRSAATKIVFLTVGLLLRQIQREPSLPQYEVLIVDEVHERHLHNDFLLGVLQRLLP
TRPDLKVILMSATINISLFSSYFSNAPVVQVPGRLFPITVVYQPQEAEPTTSKSEKLDPR
PFLRVLESIDHKYPPEERGDLLVFLSGMAEISAVLEAAQTYASHTQRWVVLPLHSALSVA
DQDKVFDVAPPGVRKCILSTNIAETSVTIDGIRFVVDSGKVKEMSYDPQAKLQRLQEFWI
SQASAEQRKGRAGRTGPGVCFRLYAESDYDAFAPYPVPEIRRVALDSLVLQMKSMSVGDP
RTFPFIEPPPPASLETAILYLRDQGALDSSEALTPIGSLLAQLPVDVVIGKMLILGSMFS
LVEPVLTIAAALSVQSPFTRSAQSSPECAAARRPLESDQGDPFTLFNVFNAWVQVKSERS
RNSRKWCRRRGIEEHRLYEMANLRRQFKELLEDHGLLAGAQAAQVGDSYSRLQQRRERRA
LHQLKRQHEEGAGRRRKVLRLQEEQDGGSSDEDRAGPAPPGASDGVDIQDVKFKLRHDLA
QLQAAASSAQDLSREQLALLKLVLGRGLYPQLAVPDAFNSSRKDSDQIFHTQAKQGAVLH
PTCVFAGSPEVLHAQELEASNCDGSRDDKDKMSSKHQLLSFVSLLETNKPYLVNCVRIPA
LQSLLLFSRSLDTNGDCSRLVADGWLELQLADSESAIRLLAASLRLRARWESALDRQLAH
QAQQQLEEEEEDTPVSPKEVATLSKELLQFTASKIPYSLRRLTGLEVQNMYVGPQTIPAT
PHLPGLFGSSTLSPHPTKGGYAVTDFLTYNCLTNDTDLYSDCLRTFWTCPHCGLHAPLTP
LERIAHENTCPQAPQDGPPGAEEAALETLQKTSVLQRPYHCEACGKDFLFTPTEVLRHRK
QHV

Sequence length

1143

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (8)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Intellectual disability	Likely pathogenic; Pathogenic	rs549149043, rs764483792	RCV000853111 RCV000853113	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Microcephaly	Likely pathogenic	rs549149043	RCV000853111	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental delay	Likely pathogenic; Pathogenic	rs549149043, rs764483792	RCV000853111 RCV000853113	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental disorder	Pathogenic	rs764483792	RCV002249548	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental disorders	Likely pathogenic; Pathogenic	rs1599751192, rs549149043, rs764483792	RCV001261684 RCV001261683 RCV001261685	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Seizure	Pathogenic	rs764483792	RCV000853113	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Short stature	Likely pathogenic	rs549149043	RCV000853111	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unilateral renal agenesis	Likely pathogenic	rs549149043	RCV000853111	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (18)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DHX34-associated thromobocytopenia	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DHX34-related disorder	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DHX34-related Neurodevelopmental Disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Moderate intellectual disability	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC KIDNEY DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYDACTYLY, POSTAXIAL	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Predisposition to thrombocytopenia	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (68)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	21741967, 23132961, 23333628, 26619301, 30168182, 8732234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	CTD_human_DG	23333628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	15514212, 7717464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	15661077, 23448392, 25295384, 30168182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	15661077, 25295384, 26635083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	25909280	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	18627030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	CTD_human_DG	25020133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	7717464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	7717464	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	17965772, 21741967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	24535227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29548821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26673618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	25045085	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29425759, 31740780, 37152370	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	24535227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	7717464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	7717464	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	23303523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	18258331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30462522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	29132544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Bone Marrow Failure Syndromes	Congenital bone marrow failure syndrome	Pubtator	33104793	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conjunctival Diseases	Conjunctival disease	Pubtator	28391980	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	23303523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	31718622	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	26635083, 39684538	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	31256877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	21336576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	21336576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	21336576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diastrophic dysplasia	Diastrophic dysplasia	Pubtator	31256877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	25723478	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	29425759	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	16299042	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	29425759	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperemia	Hyperemia	LHGDN	16888049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	16299042	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	23303523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	32098966, 33876749, 39918973	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31740780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29548821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	24535227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24535227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	29548821		★★★★★ ★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, AUTOSOMAL DOMINANT 40	Mental retardation	GENOMICS_ENGLAND_DG	31256877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Motion Sickness	Motion Sickness	BEFREE	31782104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	25293806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	32098966	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19568768, 24535227, 26673618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	21336576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	21336576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	21336576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	CTD_human_DG	12167471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	BEFREE	23132961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	Pubtator	23132961	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	21730054, 23132961, 26391399, 26635083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic Perennial	Rhinitis	Pubtator	23132961	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic Seasonal	Seasonal allergic rhinitis	Pubtator	21225011, 26598006	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis, Allergic, Perennial	Rhinitis	BEFREE	16297140, 23132961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	31969437	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizoaffective Disorder	Schizoaffective Disorder	BEFREE	27855565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	12218662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	CTD_human_DG	1912125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22782258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35587368	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

DHX34 (DExH-box helicase 34)