Gene Gene information from NCBI Gene database.
Entrez ID 9702
Gene name Centrosomal protein 57
Gene symbol CEP57
Synonyms (NCBI Gene)
MVA2PIG8TSP57
Chromosome 11
Chromosome location 11q21
Summary This gene encodes a cytoplasmic protein called Translokin. This protein localizes to the centrosome and has a function in microtubular stabilization. The N-terminal half of this protein is required for its centrosome localization and for its multimerizati
SNPs SNP information provided by dbSNP.
7
SNP ID Visualize variation Clinical significance Consequence
rs387906977 C>A,T Pathogenic Synonymous variant, stop gained, coding sequence variant, non coding transcript variant
rs577173144 G>A,C,T Likely-pathogenic, uncertain-significance Coding sequence variant, missense variant, non coding transcript variant
rs771182933 C>A,G,T Pathogenic, likely-benign Coding sequence variant, non coding transcript variant, synonymous variant, stop gained, missense variant
rs1166323407 ->CAATGTTCAGC Pathogenic Coding sequence variant, non coding transcript variant, frameshift variant
rs1555052278 A>- Pathogenic Coding sequence variant, non coding transcript variant, frameshift variant, intron variant
miRNA miRNA information provided by mirtarbase database.
231
miRTarBase ID miRNA Experiments Reference
MIRT039373 hsa-miR-421 CLASH 23622248
MIRT247082 hsa-miR-106b-5p HITS-CLIP 22473208
MIRT247079 hsa-miR-20a-5p HITS-CLIP 22473208
MIRT247082 hsa-miR-106b-5p HITS-CLIP 22473208
MIRT247078 hsa-miR-17-5p HITS-CLIP 22473208
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
24
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 15607035, 20195357, 21516116, 25416956, 27107012, 31515488, 32296183, 32814053, 33961781, 35709258
GO:0005634 Component Nucleus IEA
GO:0005634 Component Nucleus ISS 12954732
GO:0005737 Component Cytoplasm IEA
GO:0005794 Component Golgi apparatus IDA 10942595
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607951 30794 ENSG00000166037
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q86XR8
Protein name Centrosomal protein of 57 kDa (Cep57) (FGF2-interacting protein) (Testis-specific protein 57) (Translokin)
Protein function Centrosomal protein which may be required for microtubule attachment to centrosomes. May act by forming ring-like structures around microtubules. Mediates nuclear translocation and mitogenic activity of the internalized growth factor FGF2, but t
PDB 4L0R , 8IBH
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14073 Cep57_CLD 68 245 Centrosome localisation domain of Cep57 Coiled-coil
PF06657 Cep57_MT_bd 348 421 Centrosome microtubule-binding domain of Cep57 Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:12717444}.
Sequence
MAAASVSAASGSHLSNSFAEPSRSNGSMVRHSSSPYVVYPSDKPFLNSDLRRSPSKPTLA
YPESNSRAIFSALKNLQDKIRRLELERIQAEESVKTLSRETIEYKKVLDEQIQERENSKN
EESKHNQELTSQLLAAENKCNLLEKQLEYMRNMIKHAEMERTSVLEKQVSLERERQHDQT
HVQSQLEKLDLLEQEYNKLTTMQALAEKKMQELEAKLHEEEQERKRMQAKAAELQTGLET
NRLIF
EDKATPCVPNARRIKKKKSKPPEKKSSRNYFGAQPHYRLCLGDMPFVAGKSTSPS
HAVVANVQLVLHLMKQHSKALCNDRVINSIPLAKQVSSRGGKSKKLSVTPPSSNGINEEL
SEVLQTLQDEFGQMSFDHQQLAKLIQESPTVELKDKLECELEALVGRMEAKANQITKVRK
Y
QAQLEKQKLEKQKKELKATKKTLDEERNSSSRSGITGTTNKKDFMKLRPGEKRRKNLQL
LKDMQSIQNSLQSSSLCWDY
Sequence length 500
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Regulation of PLK1 Activity at G2/M Transition
Loss of Nlp from mitotic centrosomes
Recruitment of mitotic centrosome proteins and complexes
Loss of proteins required for interphase microtubule organization from the centrosome
Recruitment of NuMA to mitotic centrosomes
Anchoring of the basal body to the plasma membrane
AURKA Activation by TPX2
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
8
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Mosaic variegated aneuploidy syndrome Pathogenic rs1555052278 RCV000498788
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Mosaic variegated aneuploidy syndrome 1 Pathogenic rs1166323407 RCV000656492
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Mosaic variegated aneuploidy syndrome 2 Pathogenic; Likely pathogenic rs1399711421, rs775752088, rs1284736469, rs2496049330, rs2496263182, rs2496221057, rs1452779317, rs1565326373, rs1166323407, rs387906977, rs1565334264, rs1590962541, rs771182933, rs773014425, rs1862141371 RCV001331873
RCV001923710
RCV003078596
RCV003085098
RCV003641647
View all (10 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ALZHEIMER DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CEP57-related disorder Likely benign; Benign; Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Sarcoma Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Ambiguous Genitalia Ambiguous Genitalia HPO_DG
★☆☆☆☆
Found in Text Mining only
Aneuploidy Aneuploidy Pubtator 21552266 Associate
★☆☆☆☆
Found in Text Mining only
Aortic coarctation Aortic Coarctation HPO_DG
★☆☆☆☆
Found in Text Mining only
Aortic Valve Insufficiency Aortic Valve Insufficiency HPO_DG
★☆☆☆☆
Found in Text Mining only
Arthritis Rheumatoid Rheumatoid arthritis Pubtator 32831971 Associate
★☆☆☆☆
Found in Text Mining only
Atrial Septal Defects Atrial Septal Defect HPO_DG
★☆☆☆☆
Found in Text Mining only
Brachydactyly Brachydactyly Pubtator 35434947 Associate
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 11753653, 21803008
★☆☆☆☆
Found in Text Mining only
Cafe au lait spots, multiple Cafe-au-lait spot HPO_DG
★☆☆☆☆
Found in Text Mining only
Carcinoma Carcinoma Pubtator 28553959 Associate
★☆☆☆☆
Found in Text Mining only