Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9700
Gene name	Extra spindle pole bodies like 1, separase
Gene symbol	ESPL1
Synonyms (NCBI Gene)	ESP1SEPA
Chromosome	12
Chromosome location	12q13.13
Summary	Stable cohesion between sister chromatids before anaphase and their timely separation during anaphase are critical for chromosome inheritance. In vertebrates, sister chromatid cohesion is released in 2 steps via distinct mechanisms. The first step involve

144

Show/Hide all (144)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016597	hsa-miR-193b-3p	Microarray	20304954
MIRT026060	hsa-miR-196a-5p	Sequencing	20371350
MIRT032164	hsa-let-7d-5p	Sequencing	20371350
MIRT047734	hsa-miR-10a-5p	CLASH	23622248
MIRT047005	hsa-miR-210-3p	CLASH	23622248
MIRT045591	hsa-miR-149-5p	CLASH	23622248
MIRT039621	hsa-miR-615-3p	CLASH	23622248
MIRT039621	hsa-miR-615-3p	CLASH	23622248
MIRT065701	hsa-miR-4500	PAR-CLIP	21572407
MIRT065684	hsa-let-7a-5p	PAR-CLIP	21572407
MIRT065685	hsa-let-7b-5p	PAR-CLIP	21572407
MIRT065686	hsa-let-7c-5p	PAR-CLIP	21572407
MIRT032164	hsa-let-7d-5p	PAR-CLIP	21572407
MIRT065687	hsa-let-7e-5p	PAR-CLIP	21572407
MIRT065688	hsa-let-7f-5p	PAR-CLIP	21572407
MIRT065691	hsa-let-7g-5p	PAR-CLIP	21572407
MIRT065692	hsa-let-7i-5p	PAR-CLIP	21572407
MIRT065689	hsa-miR-98-5p	PAR-CLIP	21572407
MIRT065700	hsa-miR-4458	PAR-CLIP	21572407
MIRT523855	hsa-miR-6813-3p	PAR-CLIP	21572407
MIRT065704	hsa-miR-4773	PAR-CLIP	21572407
MIRT065698	hsa-miR-3927-3p	PAR-CLIP	21572407
MIRT065709	hsa-miR-6831-5p	PAR-CLIP	21572407
MIRT065695	hsa-miR-432-5p	PAR-CLIP	21572407
MIRT065702	hsa-miR-3975	PAR-CLIP	21572407
MIRT065705	hsa-miR-2467-5p	PAR-CLIP	21572407
MIRT065694	hsa-miR-485-5p	PAR-CLIP	21572407
MIRT065710	hsa-miR-6884-5p	PAR-CLIP	21572407
MIRT065697	hsa-miR-3188	PAR-CLIP	21572407
MIRT523854	hsa-miR-3689d	PAR-CLIP	21572407
MIRT523853	hsa-miR-6851-5p	PAR-CLIP	21572407
MIRT065708	hsa-miR-6815-3p	PAR-CLIP	21572407
MIRT065703	hsa-miR-4650-3p	PAR-CLIP	21572407
MIRT523852	hsa-miR-1287-3p	PAR-CLIP	21572407
MIRT065699	hsa-miR-4443	PAR-CLIP	21572407
MIRT065706	hsa-miR-6515-5p	PAR-CLIP	21572407
MIRT065701	hsa-miR-4500	PAR-CLIP	23446348
MIRT065684	hsa-let-7a-5p	PAR-CLIP	23446348
MIRT065685	hsa-let-7b-5p	PAR-CLIP	23446348
MIRT065686	hsa-let-7c-5p	PAR-CLIP	23446348
MIRT032164	hsa-let-7d-5p	PAR-CLIP	23446348
MIRT065687	hsa-let-7e-5p	PAR-CLIP	23446348
MIRT065688	hsa-let-7f-5p	PAR-CLIP	23446348
MIRT065691	hsa-let-7g-5p	PAR-CLIP	23446348
MIRT065692	hsa-let-7i-5p	PAR-CLIP	23446348
MIRT065689	hsa-miR-98-5p	PAR-CLIP	23446348
MIRT065700	hsa-miR-4458	PAR-CLIP	23446348
MIRT523855	hsa-miR-6813-3p	PAR-CLIP	23446348
MIRT065704	hsa-miR-4773	PAR-CLIP	23446348
MIRT065698	hsa-miR-3927-3p	PAR-CLIP	23446348
MIRT065709	hsa-miR-6831-5p	PAR-CLIP	23446348
MIRT065695	hsa-miR-432-5p	PAR-CLIP	23446348
MIRT065702	hsa-miR-3975	PAR-CLIP	23446348
MIRT065705	hsa-miR-2467-5p	PAR-CLIP	23446348
MIRT065694	hsa-miR-485-5p	PAR-CLIP	23446348
MIRT065710	hsa-miR-6884-5p	PAR-CLIP	23446348
MIRT065697	hsa-miR-3188	PAR-CLIP	23446348
MIRT523854	hsa-miR-3689d	PAR-CLIP	23446348
MIRT523853	hsa-miR-6851-5p	PAR-CLIP	23446348
MIRT065708	hsa-miR-6815-3p	PAR-CLIP	23446348
MIRT065703	hsa-miR-4650-3p	PAR-CLIP	23446348
MIRT523852	hsa-miR-1287-3p	PAR-CLIP	23446348
MIRT065699	hsa-miR-4443	PAR-CLIP	23446348
MIRT065706	hsa-miR-6515-5p	PAR-CLIP	23446348
MIRT065701	hsa-miR-4500	PAR-CLIP	21572407
MIRT065684	hsa-let-7a-5p	PAR-CLIP	21572407
MIRT065685	hsa-let-7b-5p	PAR-CLIP	21572407
MIRT065686	hsa-let-7c-5p	PAR-CLIP	21572407
MIRT032164	hsa-let-7d-5p	PAR-CLIP	21572407
MIRT065687	hsa-let-7e-5p	PAR-CLIP	21572407
MIRT065688	hsa-let-7f-5p	PAR-CLIP	21572407
MIRT065691	hsa-let-7g-5p	PAR-CLIP	21572407
MIRT065692	hsa-let-7i-5p	PAR-CLIP	21572407
MIRT065689	hsa-miR-98-5p	PAR-CLIP	21572407
MIRT065700	hsa-miR-4458	PAR-CLIP	21572407
MIRT523855	hsa-miR-6813-3p	PAR-CLIP	21572407
MIRT065704	hsa-miR-4773	PAR-CLIP	21572407
MIRT065698	hsa-miR-3927-3p	PAR-CLIP	21572407
MIRT065709	hsa-miR-6831-5p	PAR-CLIP	21572407
MIRT065695	hsa-miR-432-5p	PAR-CLIP	21572407
MIRT065702	hsa-miR-3975	PAR-CLIP	21572407
MIRT065705	hsa-miR-2467-5p	PAR-CLIP	21572407
MIRT065694	hsa-miR-485-5p	PAR-CLIP	21572407
MIRT065710	hsa-miR-6884-5p	PAR-CLIP	21572407
MIRT065697	hsa-miR-3188	PAR-CLIP	21572407
MIRT523854	hsa-miR-3689d	PAR-CLIP	21572407
MIRT523853	hsa-miR-6851-5p	PAR-CLIP	21572407
MIRT065708	hsa-miR-6815-3p	PAR-CLIP	21572407
MIRT065703	hsa-miR-4650-3p	PAR-CLIP	21572407
MIRT523852	hsa-miR-1287-3p	PAR-CLIP	21572407
MIRT065699	hsa-miR-4443	PAR-CLIP	21572407
MIRT065706	hsa-miR-6515-5p	PAR-CLIP	21572407
MIRT065701	hsa-miR-4500	PAR-CLIP	23446348
MIRT065684	hsa-let-7a-5p	PAR-CLIP	23446348
MIRT065685	hsa-let-7b-5p	PAR-CLIP	23446348
MIRT065686	hsa-let-7c-5p	PAR-CLIP	23446348
MIRT032164	hsa-let-7d-5p	PAR-CLIP	23446348
MIRT065687	hsa-let-7e-5p	PAR-CLIP	23446348
MIRT065688	hsa-let-7f-5p	PAR-CLIP	23446348
MIRT065691	hsa-let-7g-5p	PAR-CLIP	23446348
MIRT065692	hsa-let-7i-5p	PAR-CLIP	23446348
MIRT065689	hsa-miR-98-5p	PAR-CLIP	23446348
MIRT065700	hsa-miR-4458	PAR-CLIP	23446348
MIRT523855	hsa-miR-6813-3p	PAR-CLIP	23446348
MIRT065704	hsa-miR-4773	PAR-CLIP	23446348
MIRT065698	hsa-miR-3927-3p	PAR-CLIP	23446348
MIRT065709	hsa-miR-6831-5p	PAR-CLIP	23446348
MIRT065695	hsa-miR-432-5p	PAR-CLIP	23446348
MIRT065702	hsa-miR-3975	PAR-CLIP	23446348
MIRT065705	hsa-miR-2467-5p	PAR-CLIP	23446348
MIRT065694	hsa-miR-485-5p	PAR-CLIP	23446348
MIRT065710	hsa-miR-6884-5p	PAR-CLIP	23446348
MIRT065697	hsa-miR-3188	PAR-CLIP	23446348
MIRT523854	hsa-miR-3689d	PAR-CLIP	23446348
MIRT523853	hsa-miR-6851-5p	PAR-CLIP	23446348
MIRT065708	hsa-miR-6815-3p	PAR-CLIP	23446348
MIRT065703	hsa-miR-4650-3p	PAR-CLIP	23446348
MIRT523852	hsa-miR-1287-3p	PAR-CLIP	23446348
MIRT065699	hsa-miR-4443	PAR-CLIP	23446348
MIRT065706	hsa-miR-6515-5p	PAR-CLIP	23446348
MIRT970240	hsa-let-7a	CLIP-seq
MIRT970241	hsa-let-7b	CLIP-seq
MIRT970242	hsa-let-7c	CLIP-seq
MIRT970243	hsa-let-7d	CLIP-seq
MIRT970244	hsa-let-7e	CLIP-seq
MIRT970245	hsa-let-7f	CLIP-seq
MIRT970246	hsa-let-7g	CLIP-seq
MIRT970247	hsa-let-7i	CLIP-seq
MIRT970248	hsa-miR-3159	CLIP-seq
MIRT970249	hsa-miR-3927	CLIP-seq
MIRT970250	hsa-miR-432	CLIP-seq
MIRT970251	hsa-miR-4521	CLIP-seq
MIRT970252	hsa-miR-98	CLIP-seq
MIRT970240	hsa-let-7a	CLIP-seq
MIRT970241	hsa-let-7b	CLIP-seq
MIRT970242	hsa-let-7c	CLIP-seq
MIRT970243	hsa-let-7d	CLIP-seq
MIRT970244	hsa-let-7e	CLIP-seq
MIRT970245	hsa-let-7f	CLIP-seq
MIRT970246	hsa-let-7g	CLIP-seq
MIRT970247	hsa-let-7i	CLIP-seq
MIRT970249	hsa-miR-3927	CLIP-seq
MIRT970250	hsa-miR-432	CLIP-seq
MIRT970252	hsa-miR-98	CLIP-seq

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000070	Process	Mitotic sister chromatid segregation	IEA
GO:0000070	Process	Mitotic sister chromatid segregation	IMP	12672959
GO:0000212	Process	Meiotic spindle organization	IEA
GO:0000278	Process	Mitotic cell cycle	IEA
GO:0000280	Process	Nuclear division	IEA
GO:0000281	Process	Mitotic cytokinesis	NAS	11509732
GO:0003824	Function	Catalytic activity	NAS	12672959
GO:0004197	Function	Cysteine-type endopeptidase activity	IBA
GO:0004197	Function	Cysteine-type endopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	12194817, 12672959
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IDA	12672959
GO:0005829	Component	Cytosol	TAS
GO:0006508	Process	Proteolysis	IEA
GO:0006915	Process	Apoptotic process	TAS	11875078
GO:0007059	Process	Chromosome segregation	IEA
GO:0007059	Process	Chromosome segregation	IEA
GO:0007127	Process	Meiosis I	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	NAS	12672959
GO:0008234	Function	Cysteine-type peptidase activity	TAS
GO:0016787	Function	Hydrolase activity	IEA
GO:0040001	Process	Establishment of mitotic spindle localization	NAS	12672959
GO:0045143	Process	Homologous chromosome segregation	IEA
GO:0045842	Process	Positive regulation of mitotic metaphase/anaphase transition	NAS	12672959
GO:0045875	Process	Negative regulation of sister chromatid cohesion	NAS	12194817
GO:0051306	Process	Mitotic sister chromatid separation	TAS
GO:0051307	Process	Meiotic chromosome separation	IBA
GO:0072686	Component	Mitotic spindle	IBA
GO:0098813	Process	Nuclear chromosome segregation	IEA

MIM	HGNC	e!Ensembl
604143	16856	ENSG00000135476

Q14674

Protein name

Separin (EC 3.4.22.49) (Caspase-like protein ESPL1) (Extra spindle poles-like 1 protein) (Separase)

Protein function

Caspase-like protease, which plays a central role in the chromosome segregation by cleaving the SCC1/RAD21 subunit of the cohesin complex at the onset of anaphase. During most of the cell cycle, it is inactivated by different mechanisms. {ECO:00

PDB

7NJ0 , 7NJ1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03568	Peptidase_C50	1720 → 2069		Family

Sequence

MRSFKRVNFGTLLSSQKEAEELLPALKEFLSNPPAGFPSSRSDAERRQACDAILRACNQQ
LTAKLACPRHLGSLLELAELACDGYLVSTPQRPPLYLERILFVLLRNAAAQGSPEATLRL
AQPLHACLVQCSREAAPQDYEAVARGSFSLLWKGAEALLERRAAFAARLKALSFLVLLED
ESTPCEVPHFASPTACRAVAAHQLFDASGHGLNEADADFLDDLLSRHVIRALVGERGSSS
GLLSPQRALCLLELTLEHCRRFCWSRHHDKAISAVEKAHSYLRNTNLAPSLQLCQLGVKL
LQVGEEGPQAVAKLLIKASAVLSKSMEAPSPPLRALYESCQFFLSGLERGTKRRYRLDAI
LSLFAFLGGYCSLLQQLRDDGVYGGSSKQQQSFLQMYFQGLHLYTVVVYDFAQGCQIVDL
ADLTQLVDSCKSTVVWMLEALEGLSGQELTDHMGMTASYTSNLAYSFYSHKLYAEACAIS
EPLCQHLGLVKPGTYPEVPPEKLHRCFRLQVESLKKLGKQAQGCKMVILWLAALQPCSPE
HMAEPVTFWVRVKMDAARAGDKELQLKTLRDSLSGWDPETLALLLREELQAYKAVRADTG
QERFNIICDLLELSPEETPAGAWARATHLVELAQVLCYHDFTQQTNCSALDAIREALQLL
DSVRPEAQARDQLLDDKAQALLWLYICTLEAKMQEGIERDRRAQAPGNLEEFEVNDLNYE
DKLQEDRFLYSNIAFNLAADAAQSKCLDQALALWKELLTKGQAPAVRCLQQTAASLQILA
ALYQLVAKPMQALEVLLLLRIVSERLKDHSKAAGSSCHITQLLLTLGCPSYAQLHLEEAA
SSLKHLDQTTDTYLLLSLTCDLLRSQLYWTHQKVTKGVSLLLSVLRDPALQKSSKAWYLL
RVQVLQLVAAYLSLPSNNLSHSLWEQLCAQGWQTPEIALIDSHKLLRSIILLLMGSDILS
TQKAAVETSFLDYGENLVQKWQVLSEVLSCSEKLVCHLGRLGSVSEAKAFCLEALKLTTK
LQIPRQCALFLVLKGELELARNDIDLCQSDLQQVLFLLESCTEFGGVTQHLDSVKKVHLQ
KGKQQAQVPCPPQLPEEELFLRGPALELVATVAKEPGPIAPSTNSSPVLKTKPQPIPNFL
SHSPTCDCSLCASPVLTAVCLRWVLVTAGVRLAMGHQAQGLDLLQVVLKGCPEAAERLTQ
ALQASLNHKTPPSLVPSLLDEILAQAYTLLALEGLNQPSNESLQKVLQSGLKFVAARIPH
LEPWRASLLLIWALTKLGGLSCCTTQLFASSWGWQPPLIKSVPGSEPSKTQGQKRSGRGR
QKLASAPLRLNNTSQKGLEGRGLPCTPKPPDRIRQAGPHVPFTVFEEVCPTESKPEVPQA
PRVQQRVQTRLKVNFSDDSDLEDPVSAEAWLAEEPKRRGTASRGRGRARKGLSLKTDAVV
APGSAPGNPGLNGRSRRAKKVASRHCEERRPQRASDQARPGPEIMRTIPEEELTDNWRKM
SFEILRGSDGEDSASGGKTPAPGPEAASGEWELLRLDSSKKKLPSPCPDKESDKDLGPRL
RLPSAPVATGLSTLDSICDSLSVAFRGISHCPPSGLYAHLCRFLALCLGHRDPYATAFLV
TESVSITCRHQLLTHLHRQLSKAQKHRGSLEIADQLQGLSLQEMPGDVPLARIQRLFSFR
ALESGHFPQPEKESFQERLALIPSGVTVCVLALATLQPGTVGNTLLLTRLEKDSPPVSVQ
IPTGQNKLHLRSVLNEFDAIQKAQKENSSCTDKREWWTGRLALDHRMEVLIASLEKSVLG
CWKGLLLPSSEEPGPAQEASRLQELLQDCGWKYPDRTLLKIMLSGAGALTPQDIQALAYG
LCPTQPERAQELLNEAVGRLQGLTVPSNSHLVLVLDKDLQKLPWESMPSLQALPVTRLPS
FRFLLSYSIIKEYGASPVLSQGVDPRSTFYVLNPHNNLSSTEEQFRANFSSEAGWRGVVG
EVPRPEQVQEALTKHDLYIYAGHGAGARFLDGQAVLRLSCRAVALLFGCSSAALAVRGNL
EGAGIVLKYIMAGCPLFLGNLWDVTDRDIDRYTEALLQGWLGAGPGAPLLYYVNQARQAP
RLKYLIGAAPIAYGLPVSLR

Sequence length

2120

Interactions

View interactions

	KEGG		Reactome
	Cell cycle Oocyte meiosis Human T-cell leukemia virus 1 infection		Separation of Sister Chromatids

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, ADENOID CYSTIC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, TRANSITIONAL CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESPL1-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SALIVARY GLAND NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (64)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	24856830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29328493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	CTD_human_DG	16762588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	19351757	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	22870341, 24792645, 26087013, 26267133, 29370237, 32253454	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	29565708		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	21799785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	24121792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Crisis	Blast crisis	Pubtator	19563513, 22870341	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	26087013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28859055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19351757	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24792645, 28859055, 30097312, 32546141, 32932728	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19351757	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19351757, 20334636, 24792645, 29370237, 32253454, 37006282, 38203427	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	21799785, 28859055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29728556, 33308056	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	26349752	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	18616699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	34143800	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34856998	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	26349752	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26349752	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	24121792	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	38203427	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37006282	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	29370237		★★★★★ ★☆☆☆☆ Found in Text Mining only
De Lange Syndrome	De lange syndrome	Pubtator	25125236	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	32170852, 33282948, 39596419	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	29884122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24792645	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24856830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24856830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	39201599	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	33308056	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	33308056	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	21799785, 26267133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	26267133, 32253454	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	29370237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29370237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	33308056	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	18616699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25086634, 28859055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	18616699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of salivary gland	Malignant neoplasm of salivary gland	CTD_human_DG	16762588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	24121792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27966791, 28859055, 29867452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	29370237		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	29370237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	29370237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	22870341, 26087013, 26267133, 27840977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19351757, 21799785, 25086634, 31553567, 31784093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	18616699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	19351757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	19351757	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	BEFREE	17652795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	19351757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	39201599	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	CTD_human_DG	16762588		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	BEFREE	21799785		★★★★★ ★☆☆☆☆ Found in Text Mining only
secondary acute myeloid leukemia	Myeloid leukemia	BEFREE	29370237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29884122	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	21799785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24121792, 31828101	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

ESPL1 (extra spindle pole bodies like 1, separase)