CD69 (CD69 molecule)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID 969
Gene name CD69 molecule
Gene symbol CD69
Synonyms (NCBI Gene)
AIMBL-AC/P26CLEC2CEA1GP32/28MLR-3
Chromosome 12
Chromosome location 12p13.31
Summary This gene encodes a member of the calcium dependent lectin superfamily of type II transmembrane receptors. Expression of the encoded protein is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may ac
miRNA miRNA information provided by mirtarbase database.
12
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all (12)
miRTarBase ID miRNA Experiments Reference
MIRT016695 hsa-miR-335-5p Microarray 18185580
MIRT728022 hsa-miR-92a-3p HITS-CLIP 22473208
MIRT728021 hsa-miR-92b-3p HITS-CLIP 22473208
MIRT728020 hsa-miR-32-5p HITS-CLIP 22473208
MIRT728022 hsa-miR-92a-3p FlowImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot 26937033
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all (3)
Transcription factor Regulation Reference
NFKB1 Unknown 10480634
RELA Unknown 10480634
SLA2 Unknown 11696592
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
19
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all (19)
GO ID Ontology Definition Evidence Reference
GO:0003376 Process Sphingosine-1-phosphate receptor signaling pathway IDA 22344443
GO:0004888 Function Transmembrane signaling receptor activity IDA 24752896
GO:0004888 Function Transmembrane signaling receptor activity TAS 8340758
GO:0005515 Function Protein binding IPI 16525420, 25416956, 32296183
GO:0005886 Component Plasma membrane IDA 37039481
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
107273 1694 ENSG00000110848
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q07108
Protein name Early activation antigen CD69 (Activation inducer molecule) (AIM) (BL-AC/P26) (C-type lectin domain family 2 member C) (EA1) (Early T-cell activation antigen p60) (GP32/28) (Leukocyte surface antigen Leu-23) (MLR-3) (CD antigen CD69)
Protein function Transmembrane protein expressed mainly on T-cells resident in mucosa that plays an essential role in immune cell homeostasis. Rapidly expressed on the surface of platelets, T-lymphocytes and NK cells upon activation by various stimuli, such as a
PDB 1E87 , 1E8I , 1FM5 , 3CCK , 3HUP , 8G94
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 102 → 196 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed on the surface of activated T-cells, B-cells, natural killer cells, neutrophils, eosinophils, epidermal Langerhans cells and platelets.
Sequence 
MSSENCFVAENSSLHPESGQENDATSPHFSTRHEGSFQVPVLCAVMNVVFITILIIALIA
LSVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATL
AVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTE
VSSMECEKNLYWICNKPYK
Sequence length 199
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
12
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (12)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ARTHRITIS — CTD, Disgenet
CTD, Disgenet
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ARTHRITIS, EXPERIMENTAL — CTD
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROID DISEASE — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT — Disgenet
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (251)
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 22897724
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 29453833
★★★★★
★☆☆☆☆
Found in Text Mining only
Adult Acute Lymphocytic Leukemia Lymphocytic Leukemia BEFREE 22897724
★★★★★
★☆☆☆☆
Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia T-Cell Lymphoma/Leukemia BEFREE 23507197
★★★★★
★☆☆☆☆
Found in Text Mining only
Allergic rhinitis (disorder) Allergic rhinitis BEFREE 23454781
★★★★★
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Alzheimer disease Pubtator 37949669 Stimulate
★★★★★
★☆☆☆☆
Found in Text Mining only
Anemia Anemia BEFREE 30371224
★★★★★
★☆☆☆☆
Found in Text Mining only
Anemia Sickle Cell Sickle cell anemia Pubtator 32411797 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Angioedema Angioedema Pubtator 8813097 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Angioedemas Hereditary Angioedema Pubtator 22288585 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only