KDM4A (lysine demethylase 4A)

Gene

• Entrez ID: 9682
• Gene name: Lysine demethylase 4A
• Gene symbol: KDM4A
• Synonyms (NCBI Gene): JHDM3A, JMJD2, JMJD2A, TDRD14A
• Chromosome: 1
• Chromosome location: 1p34.2-p34.1
• Summary: This gene is a member of the Jumonji domain 2 (JMJD2) family and encodes a protein containing a JmjN domain, a JmjC domain, a JD2H domain, two TUDOR domains, and two PHD-type zinc fingers. This nuclear protein functions as a trimethylation-specific demeth

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029498	hsa-miR-26b-5p	Microarray	19088304
MIRT052257	hsa-let-7b-5p	CLASH	23622248
MIRT050862	hsa-miR-17-5p	CLASH	23622248
MIRT041060	hsa-miR-505-3p	CLASH	23622248
MIRT053771	hsa-miR-34a-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24802408
MIRT734856	hsa-miR-137	Luciferase reporter assay, qRT-PCR, Western blot	26461474
MIRT734856	hsa-miR-137	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), Immunohistochemistry (IHC), qRT-PCR, Flow cytometry, ELISA	33499717
MIRT1084452	hsa-miR-1206	CLIP-seq
MIRT1084453	hsa-miR-1305	CLIP-seq
MIRT1084454	hsa-miR-2115	CLIP-seq
MIRT1084455	hsa-miR-299-5p	CLIP-seq
MIRT1084456	hsa-miR-3155	CLIP-seq
MIRT1084457	hsa-miR-3155b	CLIP-seq
MIRT1084458	hsa-miR-3190	CLIP-seq
MIRT1084459	hsa-miR-3194-3p	CLIP-seq
MIRT1084460	hsa-miR-346	CLIP-seq
MIRT1084461	hsa-miR-3613-3p	CLIP-seq
MIRT1084462	hsa-miR-4255	CLIP-seq
MIRT1084463	hsa-miR-4271	CLIP-seq
MIRT1084464	hsa-miR-4288	CLIP-seq
MIRT1084465	hsa-miR-4328	CLIP-seq
MIRT1084466	hsa-miR-4521	CLIP-seq
MIRT1084467	hsa-miR-4639-5p	CLIP-seq
MIRT1084468	hsa-miR-4698	CLIP-seq
MIRT1084469	hsa-miR-4716-5p	CLIP-seq
MIRT1084470	hsa-miR-4725-3p	CLIP-seq
MIRT1084471	hsa-miR-4733-3p	CLIP-seq
MIRT1084472	hsa-miR-4761-5p	CLIP-seq
MIRT1084473	hsa-miR-4763-5p	CLIP-seq
MIRT1084474	hsa-miR-4789-3p	CLIP-seq
MIRT1084475	hsa-miR-484	CLIP-seq
MIRT1084476	hsa-miR-485-3p	CLIP-seq
MIRT1084477	hsa-miR-495	CLIP-seq
MIRT1084478	hsa-miR-501-3p	CLIP-seq
MIRT1084479	hsa-miR-502-3p	CLIP-seq
MIRT1084480	hsa-miR-516a-3p	CLIP-seq
MIRT1084481	hsa-miR-607	CLIP-seq
MIRT1084482	hsa-miR-624	CLIP-seq
MIRT1084483	hsa-miR-632	CLIP-seq
MIRT1084484	hsa-miR-654-3p	CLIP-seq
MIRT1084485	hsa-miR-659	CLIP-seq
MIRT1084486	hsa-miR-760	CLIP-seq
MIRT1084487	hsa-miR-767-5p	CLIP-seq
MIRT2021418	hsa-miR-1207-3p	CLIP-seq
MIRT2021419	hsa-miR-1250	CLIP-seq
MIRT2021420	hsa-miR-125a-3p	CLIP-seq
MIRT2021421	hsa-miR-1260	CLIP-seq
MIRT2021422	hsa-miR-1260b	CLIP-seq
MIRT2021423	hsa-miR-1343	CLIP-seq
MIRT2021424	hsa-miR-1825	CLIP-seq
MIRT2021425	hsa-miR-200b	CLIP-seq
MIRT2021426	hsa-miR-200c	CLIP-seq
MIRT2021427	hsa-miR-296-5p	CLIP-seq
MIRT2021428	hsa-miR-3064-3p	CLIP-seq
MIRT2021429	hsa-miR-3065-3p	CLIP-seq
MIRT1084460	hsa-miR-346	CLIP-seq
MIRT2021430	hsa-miR-3665	CLIP-seq
MIRT2021431	hsa-miR-3690	CLIP-seq
MIRT2021432	hsa-miR-3919	CLIP-seq
MIRT2021433	hsa-miR-3942-3p	CLIP-seq
MIRT1084464	hsa-miR-4288	CLIP-seq
MIRT2021434	hsa-miR-429	CLIP-seq
MIRT2021435	hsa-miR-4290	CLIP-seq
MIRT2021436	hsa-miR-4470	CLIP-seq
MIRT2021437	hsa-miR-4520a-3p	CLIP-seq
MIRT2021438	hsa-miR-4638-3p	CLIP-seq
MIRT2021439	hsa-miR-4645-5p	CLIP-seq
MIRT2021440	hsa-miR-4673	CLIP-seq
MIRT2021441	hsa-miR-4687-5p	CLIP-seq
MIRT1084469	hsa-miR-4716-5p	CLIP-seq
MIRT2021442	hsa-miR-4742-5p	CLIP-seq
MIRT2021443	hsa-miR-4756-3p	CLIP-seq
MIRT2021444	hsa-miR-526b	CLIP-seq
MIRT1084483	hsa-miR-632	CLIP-seq
MIRT2021445	hsa-miR-634	CLIP-seq
MIRT1084484	hsa-miR-654-3p	CLIP-seq
MIRT2021446	hsa-miR-657	CLIP-seq
MIRT2252935	hsa-miR-1179	CLIP-seq
MIRT2021418	hsa-miR-1207-3p	CLIP-seq
MIRT2252936	hsa-miR-1253	CLIP-seq
MIRT2252937	hsa-miR-1262	CLIP-seq
MIRT2252938	hsa-miR-127-5p	CLIP-seq
MIRT2252939	hsa-miR-146b-3p	CLIP-seq
MIRT2252940	hsa-miR-148a	CLIP-seq
MIRT2252941	hsa-miR-148b	CLIP-seq
MIRT2252942	hsa-miR-152	CLIP-seq
MIRT2252943	hsa-miR-153	CLIP-seq
MIRT2021424	hsa-miR-1825	CLIP-seq
MIRT2252944	hsa-miR-198	CLIP-seq
MIRT2021425	hsa-miR-200b	CLIP-seq
MIRT2021426	hsa-miR-200c	CLIP-seq
MIRT2252945	hsa-miR-23a	CLIP-seq
MIRT2252946	hsa-miR-23b	CLIP-seq
MIRT2252947	hsa-miR-23c	CLIP-seq
MIRT2252948	hsa-miR-298	CLIP-seq
MIRT2252949	hsa-miR-3157-3p	CLIP-seq
MIRT2252950	hsa-miR-3173-5p	CLIP-seq
MIRT2252951	hsa-miR-320e	CLIP-seq
MIRT2252952	hsa-miR-338-3p	CLIP-seq
MIRT1084461	hsa-miR-3613-3p	CLIP-seq
MIRT2252953	hsa-miR-3616-3p	CLIP-seq
MIRT2252954	hsa-miR-3714	CLIP-seq
MIRT2021432	hsa-miR-3919	CLIP-seq
MIRT2021433	hsa-miR-3942-3p	CLIP-seq
MIRT2252955	hsa-miR-3944-5p	CLIP-seq
MIRT1084463	hsa-miR-4271	CLIP-seq
MIRT2021434	hsa-miR-429	CLIP-seq
MIRT2021435	hsa-miR-4290	CLIP-seq
MIRT2252956	hsa-miR-4310	CLIP-seq
MIRT1084465	hsa-miR-4328	CLIP-seq
MIRT2252957	hsa-miR-4436b-3p	CLIP-seq
MIRT2252958	hsa-miR-4492	CLIP-seq
MIRT2252959	hsa-miR-4498	CLIP-seq
MIRT2252960	hsa-miR-455-3p	CLIP-seq
MIRT2252961	hsa-miR-4640-5p	CLIP-seq
MIRT2021439	hsa-miR-4645-5p	CLIP-seq
MIRT2252962	hsa-miR-4652-3p	CLIP-seq
MIRT2021440	hsa-miR-4673	CLIP-seq
MIRT2252963	hsa-miR-4676-5p	CLIP-seq
MIRT2252964	hsa-miR-4691-3p	CLIP-seq
MIRT2252965	hsa-miR-4701-3p	CLIP-seq
MIRT1084469	hsa-miR-4716-5p	CLIP-seq
MIRT2252966	hsa-miR-4721	CLIP-seq
MIRT1084470	hsa-miR-4725-3p	CLIP-seq
MIRT2252967	hsa-miR-4726-5p	CLIP-seq
MIRT2021443	hsa-miR-4756-3p	CLIP-seq
MIRT1084474	hsa-miR-4789-3p	CLIP-seq
MIRT1084476	hsa-miR-485-3p	CLIP-seq
MIRT1084477	hsa-miR-495	CLIP-seq
MIRT2252968	hsa-miR-575	CLIP-seq
MIRT1084484	hsa-miR-654-3p	CLIP-seq
MIRT2252969	hsa-miR-762	CLIP-seq
MIRT2252970	hsa-miR-874	CLIP-seq
MIRT2252935	hsa-miR-1179	CLIP-seq
MIRT2252936	hsa-miR-1253	CLIP-seq
MIRT2252937	hsa-miR-1262	CLIP-seq
MIRT2555914	hsa-miR-1269	CLIP-seq
MIRT2555915	hsa-miR-1269b	CLIP-seq
MIRT2555916	hsa-miR-1288	CLIP-seq
MIRT2555917	hsa-miR-1298	CLIP-seq
MIRT2555918	hsa-miR-145	CLIP-seq
MIRT2252940	hsa-miR-148a	CLIP-seq
MIRT2252941	hsa-miR-148b	CLIP-seq
MIRT2252942	hsa-miR-152	CLIP-seq
MIRT2021424	hsa-miR-1825	CLIP-seq
MIRT2555919	hsa-miR-199a-5p	CLIP-seq
MIRT2555920	hsa-miR-199b-5p	CLIP-seq
MIRT1084454	hsa-miR-2115	CLIP-seq
MIRT1084456	hsa-miR-3155	CLIP-seq
MIRT1084457	hsa-miR-3155b	CLIP-seq
MIRT1084459	hsa-miR-3194-3p	CLIP-seq
MIRT2252955	hsa-miR-3944-5p	CLIP-seq
MIRT2252956	hsa-miR-4310	CLIP-seq
MIRT2555921	hsa-miR-4515	CLIP-seq
MIRT2252961	hsa-miR-4640-5p	CLIP-seq
MIRT2252964	hsa-miR-4691-3p	CLIP-seq
MIRT2252965	hsa-miR-4701-3p	CLIP-seq
MIRT2252967	hsa-miR-4726-5p	CLIP-seq
MIRT1084471	hsa-miR-4733-3p	CLIP-seq
MIRT2555922	hsa-miR-4740-5p	CLIP-seq
MIRT1084473	hsa-miR-4763-5p	CLIP-seq
MIRT1084475	hsa-miR-484	CLIP-seq
MIRT1084480	hsa-miR-516a-3p	CLIP-seq
MIRT1084486	hsa-miR-760	CLIP-seq
MIRT2252935	hsa-miR-1179	CLIP-seq
MIRT2252936	hsa-miR-1253	CLIP-seq
MIRT2252937	hsa-miR-1262	CLIP-seq
MIRT2555914	hsa-miR-1269	CLIP-seq
MIRT2555915	hsa-miR-1269b	CLIP-seq
MIRT2555916	hsa-miR-1288	CLIP-seq
MIRT2555918	hsa-miR-145	CLIP-seq
MIRT2252940	hsa-miR-148a	CLIP-seq
MIRT2252941	hsa-miR-148b	CLIP-seq
MIRT2252942	hsa-miR-152	CLIP-seq
MIRT2021424	hsa-miR-1825	CLIP-seq
MIRT2555919	hsa-miR-199a-5p	CLIP-seq
MIRT2555920	hsa-miR-199b-5p	CLIP-seq
MIRT1084454	hsa-miR-2115	CLIP-seq
MIRT2683270	hsa-miR-3127-5p	CLIP-seq
MIRT1084456	hsa-miR-3155	CLIP-seq
MIRT1084457	hsa-miR-3155b	CLIP-seq
MIRT1084459	hsa-miR-3194-3p	CLIP-seq
MIRT2252955	hsa-miR-3944-5p	CLIP-seq
MIRT2252956	hsa-miR-4310	CLIP-seq
MIRT2555921	hsa-miR-4515	CLIP-seq
MIRT2252961	hsa-miR-4640-5p	CLIP-seq
MIRT2683271	hsa-miR-4668-3p	CLIP-seq
MIRT2683272	hsa-miR-4690-3p	CLIP-seq
MIRT2252964	hsa-miR-4691-3p	CLIP-seq
MIRT2252965	hsa-miR-4701-3p	CLIP-seq
MIRT2252967	hsa-miR-4726-5p	CLIP-seq
MIRT1084471	hsa-miR-4733-3p	CLIP-seq
MIRT2555922	hsa-miR-4740-5p	CLIP-seq
MIRT2683273	hsa-miR-4749-3p	CLIP-seq
MIRT1084473	hsa-miR-4763-5p	CLIP-seq
MIRT1084475	hsa-miR-484	CLIP-seq
MIRT1084480	hsa-miR-516a-3p	CLIP-seq
MIRT2683274	hsa-miR-605	CLIP-seq
MIRT1084486	hsa-miR-760	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IBA
GO:0001650	Component	Fibrillar center	IDA
GO:0005515	Function	Protein binding	IPI	16415788, 16603238, 17567753, 22373579, 27109047, 37179361
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	16024779
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	IMP	21914792
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005721	Component	Pericentric heterochromatin	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IBA
GO:0008270	Function	Zinc ion binding	IDA	27214403
GO:0008270	Function	Zinc ion binding	IEA
GO:0010468	Process	Regulation of gene expression	IBA
GO:0010507	Process	Negative regulation of autophagy	IMP	25660547
GO:0010629	Process	Negative regulation of gene expression	IMP	25660547
GO:0014898	Process	Cardiac muscle hypertrophy in response to stress	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	22373579
GO:0032452	Function	Histone demethylase activity	IEA
GO:0032452	Function	Histone demethylase activity	TAS
GO:0032454	Function	Histone H3K9 demethylase activity	IBA
GO:0032454	Function	Histone H3K9 demethylase activity	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	16024779
GO:0046872	Function	Metal ion binding	IEA
GO:0051213	Function	Dioxygenase activity	IEA
GO:0051864	Function	Histone H3K36 demethylase activity	IBA
GO:0051864	Function	Histone H3K36 demethylase activity	IDA	16024779, 21914792
GO:0051864	Function	Histone H3K36 demethylase activity	IEA
GO:0140005	Function	Histone H4K20me2 reader activity	IDA	22373579
GO:0140681	Function	Histone H3K36me2/H3K36me3 demethylase activity	IEA
GO:0140684	Function	Histone H3K9me2/H3K9me3 demethylase activity	IEA
GO:0140684	Function	Histone H3K9me2/H3K9me3 demethylase activity	IMP	21914792

Other IDs

• MIM: 609764
• HGNC: 22978
• e!Ensembl: ENSG00000066135

Protein

• UniProt ID: O75164
• Protein name: Lysine-specific demethylase 4A (EC 1.14.11.66) (EC 1.14.11.69) (JmjC domain-containing histone demethylation protein 3A) (Jumonji domain-containing protein 2A) ([histone H3]-trimethyl-L-lysine(36) demethylase 4A) ([histone H3]-trimethyl-L-lysine(9) demeth
• Protein function: Histone demethylase that specifically demethylates 'Lys-9' and 'Lys-36' residues of histone H3, thereby playing a central role in histone code (PubMed:26741168, PubMed:21768309). Does not demethylate histone H3 'Lys-4', H3 'Lys-27' nor H4 'Lys-2
• PDB: 2GF7, 2GFA, 2GP3, 2GP5, 2OQ6, 2OQ7, 2OS2, 2OT7, 2OX0, 2P5B, 2PXJ, 2Q8C, 2Q8D, 2Q8E, 2QQR, 2QQS, 2VD7, 2WWJ, 2YBK, 2YBP, 2YBS, 3NJY, 3PDQ, 3RVH, 3U4S, 4AI9, 4BIS, 4GD4, 4URA, 4V2V, 4V2W, 5A7N, 5A7O, 5A7P, 5A7Q, 5A7S, 5A7W, 5A80, 5ANQ, 5D6W, 5D6X, 5D6Y, 5F2S, 5F2W, 5F32, 5F37, 5F39, 5F3C, 5F3E, 5F3G, 5F3I
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02375	JmjN	15 → 49	jmjN domain	Family
  PF02373	JmjC	175 → 291	JmjC domain, hydroxylase	Domain
  PF13831	PHD_2	732 → 767		Family
  PF13832	zf-HC5HC2H_2	773 → 884		Domain
  PF18104	Tudor_2	902 → 936	Jumonji domain-containing protein 2A Tudor domain	Domain
  PF18104	Tudor_2	960 → 994	Jumonji domain-containing protein 2A Tudor domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:15927959}.
• Sequence:

  MASESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYD
  DIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERK
  YWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGM
  WKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRH
  KMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYG
  KQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLKESELP
  PRAGNEEECPEEDMEGVEDGEEGDLKTSLAKHRIGTKRHRVCLEIPQEVSQSELFPKEDL
  SSEQYEMTECPAALAPVRPTHSSVRQVEDGLTFPDYSDSTEVKFEELKNVKLEEEDEEEE
  QAAAALDLSVNPASVGGRLVFSGSKKKSSSSLGSGSSRDSISSDSETSEPLSCRAQGQTG
  VLTVHSYAKGDGRVTVGEPCTRKKGSAARSFSERELAEVADEYMFSLEENKKSKGRRQPL
  SKLPRHHPLVLQECVSDDETSEQLTPEEEAEETEAWAKPLSQLWQNRPPNFEAEKEFNET
  MAQQAPHCAVCMIFQTYHQVEFGGFNQNCGNASDLAPQKQRTKPLIPEMCFTSTGCSTDI
  NLSTPYLEEDGTSILVSCKKCSVRVHASCYGVPPAKASEDWMCSRCSANALEEDCCLCSL
  RGGALQRANDDRWVHVSCAVAILEARFVNIAERSPVDVSKIPLPRFKLKCIFCKKRRKRT
  AGCCVQCSHGRCPTAFHVSCAQAAGVMMQPDDWPFVVFITCFRHKIPNLERAKGALQSIT
  AGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEG
  EVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELPKRVKSRLSV
  ASDMRFNEIFTEKEVKQEKKRQRVINSRYREDYIEPALYRAIME

• Sequence length: 1064

Pathways

Reactome:

HDMs demethylate histones
Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks
NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMYOTROPHIC LATERAL SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	28059867		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	27743893		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29383092		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29383092		★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	29413154	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	31364745		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21962223, 22948256, 24886710, 25193278		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21962223, 35833065	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	15927959, 28693517, 29393482, 34111227	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	29599352		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32481346, 32883983, 36973424, 39210306	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	21400613	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	31364745		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23168260, 26498874		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30720092		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30720092		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30426231		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28511912		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22134899		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	21962223	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	27711046		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	24815446, 26397136		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	24815446	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36965032	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	27514525		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37873881	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	21555854		★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	21555854		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	25961932	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	35340126	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	31434704		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26722485	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21400613, 26722485	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	27711046		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Glioma	Glioma	BEFREE	27514525		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21962223, 22948256, 24886710, 25193278		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	26397136		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	28467776		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23168260, 26498874		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22120715, 23384557, 26364928, 26731476, 27626669, 27743893, 28346812, 29393482, 30302800		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	24802408, 31349968, 31677131		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	31364745		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21962223, 25633974, 26904954, 28212444, 29393482		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30720092		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22134899		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	22199269, 22948256, 26755726		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	CTD_human_DG	29438700		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meningioma	Meningioma	Pubtator	26240495	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	27711046		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	27711046		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	31515577		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28693517		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	28693517	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22199269, 23168260, 23589305, 24802408, 24886710, 25719312, 26364928, 26498874, 26731476, 26904954, 27626669, 28693517, 28894274, 30720092, 31677131		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25564517, 25719312, 26498874, 28059867, 30967636		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	31515577		★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	30302800		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	26904954		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	22120715, 23384557, 26364928, 26731476, 27626669, 27743893, 28346812, 29393482, 30302800		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	26731476		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24971742, 25189356, 27109047, 29393482, 37165308, 37870957	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	26731476, 27109047, 29393482		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	26904954		★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	35914074	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	23633675, 29113308		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	15138608		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	24802408, 31349968, 31677131		★☆☆☆☆ Found in Text Mining only
Triglyceride storage disease with ichthyosis	Triglyceride Storage Disease With Ichthyosis	BEFREE	31677131		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	21400613	Associate	★☆☆☆☆ Found in Text Mining only