CD68 (CD68 molecule)

Gene

• Entrez ID: 968
• Gene name: CD68 molecule
• Gene symbol: CD68
• Synonyms (NCBI Gene): GP110, LAMP4, SCARD1
• Chromosome: 17
• Chromosome location: 17p13.1
• Summary: This gene encodes a 110-kD transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. It is a member of the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family. The protein primarily localizes to lysosome

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT020775	hsa-miR-155-5p	Western blot	21030878
MIRT650254	hsa-miR-4282	HITS-CLIP	23824327
MIRT650253	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT650252	hsa-miR-3163	HITS-CLIP	23824327
MIRT650251	hsa-miR-1470	HITS-CLIP	23824327
MIRT650250	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT650249	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT650248	hsa-miR-4469	HITS-CLIP	23824327
MIRT650247	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT650246	hsa-miR-4287	HITS-CLIP	23824327
MIRT650245	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT650244	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT650243	hsa-miR-4713-5p	HITS-CLIP	23824327
MIRT650241	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT650242	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT650240	hsa-miR-629-3p	HITS-CLIP	23824327
MIRT650239	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT650238	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT650254	hsa-miR-4282	HITS-CLIP	23824327
MIRT650253	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT650252	hsa-miR-3163	HITS-CLIP	23824327
MIRT650251	hsa-miR-1470	HITS-CLIP	23824327
MIRT650250	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT650249	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT650248	hsa-miR-4469	HITS-CLIP	23824327
MIRT650247	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT650246	hsa-miR-4287	HITS-CLIP	23824327
MIRT650245	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT650244	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT650243	hsa-miR-4713-5p	HITS-CLIP	23824327
MIRT650241	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT650242	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT650240	hsa-miR-629-3p	HITS-CLIP	23824327
MIRT650239	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT650238	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT876125	hsa-miR-1245	CLIP-seq
MIRT876126	hsa-miR-1825	CLIP-seq
MIRT876127	hsa-miR-199a-5p	CLIP-seq
MIRT876128	hsa-miR-199b-5p	CLIP-seq
MIRT876129	hsa-miR-371-5p	CLIP-seq
MIRT876130	hsa-miR-371b-5p	CLIP-seq
MIRT876131	hsa-miR-3925-3p	CLIP-seq
MIRT876132	hsa-miR-640	CLIP-seq
MIRT876133	hsa-miR-1207-3p	CLIP-seq
MIRT876134	hsa-miR-1972	CLIP-seq
MIRT876135	hsa-miR-4438	CLIP-seq
MIRT876136	hsa-miR-5095	CLIP-seq
MIRT876137	hsa-miR-562	CLIP-seq
MIRT1959672	hsa-miR-150	CLIP-seq
MIRT1959673	hsa-miR-3187-3p	CLIP-seq
MIRT1959674	hsa-miR-3663-5p	CLIP-seq
MIRT876129	hsa-miR-371-5p	CLIP-seq
MIRT876130	hsa-miR-371b-5p	CLIP-seq
MIRT1959675	hsa-miR-4435	CLIP-seq
MIRT876135	hsa-miR-4438	CLIP-seq
MIRT1959676	hsa-miR-4701-5p	CLIP-seq
MIRT1959677	hsa-miR-4716-5p	CLIP-seq
MIRT1959678	hsa-miR-4727-5p	CLIP-seq
MIRT1959679	hsa-miR-4755-3p	CLIP-seq
MIRT1959680	hsa-miR-4781-3p	CLIP-seq
MIRT876136	hsa-miR-5095	CLIP-seq
MIRT1959681	hsa-miR-548s	CLIP-seq
MIRT1959682	hsa-miR-588	CLIP-seq
MIRT876125	hsa-miR-1245	CLIP-seq
MIRT2196679	hsa-miR-1343	CLIP-seq
MIRT876126	hsa-miR-1825	CLIP-seq
MIRT876127	hsa-miR-199a-5p	CLIP-seq
MIRT876128	hsa-miR-199b-5p	CLIP-seq
MIRT876131	hsa-miR-3925-3p	CLIP-seq
MIRT2196680	hsa-miR-4277	CLIP-seq
MIRT1959678	hsa-miR-4727-5p	CLIP-seq
MIRT2196681	hsa-miR-498	CLIP-seq
MIRT876132	hsa-miR-640	CLIP-seq
MIRT2385755	hsa-miR-106a	CLIP-seq
MIRT2385756	hsa-miR-106b	CLIP-seq
MIRT876125	hsa-miR-1245	CLIP-seq
MIRT1959672	hsa-miR-150	CLIP-seq
MIRT2385757	hsa-miR-17	CLIP-seq
MIRT876126	hsa-miR-1825	CLIP-seq
MIRT876127	hsa-miR-199a-5p	CLIP-seq
MIRT876128	hsa-miR-199b-5p	CLIP-seq
MIRT2385758	hsa-miR-20a	CLIP-seq
MIRT2385759	hsa-miR-20b	CLIP-seq
MIRT2385760	hsa-miR-302a	CLIP-seq
MIRT2385761	hsa-miR-302b	CLIP-seq
MIRT2385762	hsa-miR-302c	CLIP-seq
MIRT2385763	hsa-miR-302d	CLIP-seq
MIRT2385764	hsa-miR-302e	CLIP-seq
MIRT2385765	hsa-miR-372	CLIP-seq
MIRT2385766	hsa-miR-373	CLIP-seq
MIRT876131	hsa-miR-3925-3p	CLIP-seq
MIRT876135	hsa-miR-4438	CLIP-seq
MIRT2385767	hsa-miR-4731-5p	CLIP-seq
MIRT876136	hsa-miR-5095	CLIP-seq
MIRT2385768	hsa-miR-512-3p	CLIP-seq
MIRT2385769	hsa-miR-519d	CLIP-seq
MIRT2385770	hsa-miR-520a-3p	CLIP-seq
MIRT2385771	hsa-miR-520b	CLIP-seq
MIRT2385772	hsa-miR-520c-3p	CLIP-seq
MIRT2385773	hsa-miR-520d-3p	CLIP-seq
MIRT2385774	hsa-miR-520e	CLIP-seq
MIRT2385775	hsa-miR-520g	CLIP-seq
MIRT2385776	hsa-miR-520h	CLIP-seq
MIRT876132	hsa-miR-640	CLIP-seq
MIRT2385777	hsa-miR-93	CLIP-seq
MIRT2385755	hsa-miR-106a	CLIP-seq
MIRT2385756	hsa-miR-106b	CLIP-seq
MIRT876133	hsa-miR-1207-3p	CLIP-seq
MIRT2499881	hsa-miR-1228	CLIP-seq
MIRT876125	hsa-miR-1245	CLIP-seq
MIRT2196679	hsa-miR-1343	CLIP-seq
MIRT1959672	hsa-miR-150	CLIP-seq
MIRT2385757	hsa-miR-17	CLIP-seq
MIRT876126	hsa-miR-1825	CLIP-seq
MIRT2499882	hsa-miR-197	CLIP-seq
MIRT876134	hsa-miR-1972	CLIP-seq
MIRT876127	hsa-miR-199a-5p	CLIP-seq
MIRT876128	hsa-miR-199b-5p	CLIP-seq
MIRT2385758	hsa-miR-20a	CLIP-seq
MIRT2385759	hsa-miR-20b	CLIP-seq
MIRT2385760	hsa-miR-302a	CLIP-seq
MIRT2385761	hsa-miR-302b	CLIP-seq
MIRT2385762	hsa-miR-302c	CLIP-seq
MIRT2385763	hsa-miR-302d	CLIP-seq
MIRT2385764	hsa-miR-302e	CLIP-seq
MIRT2499883	hsa-miR-3160-5p	CLIP-seq
MIRT1959673	hsa-miR-3187-3p	CLIP-seq
MIRT1959674	hsa-miR-3663-5p	CLIP-seq
MIRT876129	hsa-miR-371-5p	CLIP-seq
MIRT876130	hsa-miR-371b-5p	CLIP-seq
MIRT2385765	hsa-miR-372	CLIP-seq
MIRT2385766	hsa-miR-373	CLIP-seq
MIRT2499884	hsa-miR-375	CLIP-seq
MIRT876131	hsa-miR-3925-3p	CLIP-seq
MIRT2499885	hsa-miR-411	CLIP-seq
MIRT2196680	hsa-miR-4277	CLIP-seq
MIRT1959675	hsa-miR-4435	CLIP-seq
MIRT876135	hsa-miR-4438	CLIP-seq
MIRT2499886	hsa-miR-4537	CLIP-seq
MIRT1959676	hsa-miR-4701-5p	CLIP-seq
MIRT1959677	hsa-miR-4716-5p	CLIP-seq
MIRT1959678	hsa-miR-4727-5p	CLIP-seq
MIRT2385767	hsa-miR-4731-5p	CLIP-seq
MIRT1959679	hsa-miR-4755-3p	CLIP-seq
MIRT1959680	hsa-miR-4781-3p	CLIP-seq
MIRT2499887	hsa-miR-4794	CLIP-seq
MIRT2196681	hsa-miR-498	CLIP-seq
MIRT876136	hsa-miR-5095	CLIP-seq
MIRT2499888	hsa-miR-5096	CLIP-seq
MIRT2385768	hsa-miR-512-3p	CLIP-seq
MIRT2385769	hsa-miR-519d	CLIP-seq
MIRT2385770	hsa-miR-520a-3p	CLIP-seq
MIRT2385771	hsa-miR-520b	CLIP-seq
MIRT2385772	hsa-miR-520c-3p	CLIP-seq
MIRT2385773	hsa-miR-520d-3p	CLIP-seq
MIRT2385774	hsa-miR-520e	CLIP-seq
MIRT2385775	hsa-miR-520g	CLIP-seq
MIRT2385776	hsa-miR-520h	CLIP-seq
MIRT1959681	hsa-miR-548s	CLIP-seq
MIRT876137	hsa-miR-562	CLIP-seq
MIRT1959682	hsa-miR-588	CLIP-seq
MIRT876132	hsa-miR-640	CLIP-seq
MIRT2385777	hsa-miR-93	CLIP-seq
MIRT2385755	hsa-miR-106a	CLIP-seq
MIRT2385756	hsa-miR-106b	CLIP-seq
MIRT876133	hsa-miR-1207-3p	CLIP-seq
MIRT2499881	hsa-miR-1228	CLIP-seq
MIRT876125	hsa-miR-1245	CLIP-seq
MIRT2196679	hsa-miR-1343	CLIP-seq
MIRT1959672	hsa-miR-150	CLIP-seq
MIRT2385757	hsa-miR-17	CLIP-seq
MIRT876126	hsa-miR-1825	CLIP-seq
MIRT2499882	hsa-miR-197	CLIP-seq
MIRT876134	hsa-miR-1972	CLIP-seq
MIRT876127	hsa-miR-199a-5p	CLIP-seq
MIRT876128	hsa-miR-199b-5p	CLIP-seq
MIRT2385758	hsa-miR-20a	CLIP-seq
MIRT2385759	hsa-miR-20b	CLIP-seq
MIRT2385760	hsa-miR-302a	CLIP-seq
MIRT2385761	hsa-miR-302b	CLIP-seq
MIRT2385762	hsa-miR-302c	CLIP-seq
MIRT2385763	hsa-miR-302d	CLIP-seq
MIRT2385764	hsa-miR-302e	CLIP-seq
MIRT1959673	hsa-miR-3187-3p	CLIP-seq
MIRT1959674	hsa-miR-3663-5p	CLIP-seq
MIRT876129	hsa-miR-371-5p	CLIP-seq
MIRT876130	hsa-miR-371b-5p	CLIP-seq
MIRT2385765	hsa-miR-372	CLIP-seq
MIRT2385766	hsa-miR-373	CLIP-seq
MIRT876131	hsa-miR-3925-3p	CLIP-seq
MIRT2196680	hsa-miR-4277	CLIP-seq
MIRT1959675	hsa-miR-4435	CLIP-seq
MIRT876135	hsa-miR-4438	CLIP-seq
MIRT2499886	hsa-miR-4537	CLIP-seq
MIRT1959676	hsa-miR-4701-5p	CLIP-seq
MIRT1959677	hsa-miR-4716-5p	CLIP-seq
MIRT1959678	hsa-miR-4727-5p	CLIP-seq
MIRT2385767	hsa-miR-4731-5p	CLIP-seq
MIRT1959679	hsa-miR-4755-3p	CLIP-seq
MIRT1959680	hsa-miR-4781-3p	CLIP-seq
MIRT2196681	hsa-miR-498	CLIP-seq
MIRT876136	hsa-miR-5095	CLIP-seq
MIRT2499888	hsa-miR-5096	CLIP-seq
MIRT2385768	hsa-miR-512-3p	CLIP-seq
MIRT2385769	hsa-miR-519d	CLIP-seq
MIRT2385770	hsa-miR-520a-3p	CLIP-seq
MIRT2385771	hsa-miR-520b	CLIP-seq
MIRT2385772	hsa-miR-520c-3p	CLIP-seq
MIRT2385773	hsa-miR-520d-3p	CLIP-seq
MIRT2385774	hsa-miR-520e	CLIP-seq
MIRT2385775	hsa-miR-520g	CLIP-seq
MIRT2385776	hsa-miR-520h	CLIP-seq
MIRT1959681	hsa-miR-548s	CLIP-seq
MIRT876137	hsa-miR-562	CLIP-seq
MIRT1959682	hsa-miR-588	CLIP-seq
MIRT876132	hsa-miR-640	CLIP-seq
MIRT2385777	hsa-miR-93	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ELF1	Activation	12676954
ESR2	Unknown	11517296
IRF4	Repression	12676954
IRF8	Repression	12676954
SPI1	Repression	12676954

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002437	Process	Inflammatory response to antigenic stimulus	ISS
GO:0002605	Process	Negative regulation of dendritic cell antigen processing and presentation	ISS
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005764	Component	Lysosome	IEA
GO:0005764	Component	Lysosome	ISS
GO:0005765	Component	Lysosomal membrane	IBA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	28601280
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0010008	Component	Endosome membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	7680921
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031669	Process	Cellular response to nutrient levels	ISS
GO:0031902	Component	Late endosome membrane	IBA
GO:0035425	Process	Autocrine signaling	IEA
GO:0035577	Component	Azurophil granule membrane	TAS
GO:0045471	Process	Response to ethanol	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	ISS
GO:0072594	Process	Establishment of protein localization to organelle	IBA
GO:0140052	Process	Cellular response to oxidised low-density lipoprotein particle stimulus	ISS

Other IDs

• MIM: 153634
• HGNC: 1693
• e!Ensembl: ENSG00000129226

Protein

• UniProt ID: P34810
• Protein name: Macrosialin (Gp110) (CD antigen CD68)
• Protein function: Could play a role in phagocytic activities of tissue macrophages, both in intracellular lysosomal metabolism and extracellular cell-cell and cell-pathogen interactions. Binds to tissue- and organ-specific lectins or selectins, allowing homing of
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01299	Lamp	155 → 303	Lysosome-associated membrane glycoprotein (Lamp)	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed by blood monocytes and tissue macrophages. Also expressed in lymphocytes, fibroblasts and endothelial cells. Expressed in many tumor cell lines which could allow them to attach to selectins on vascular endothelium, fac
• Sequence:

  MRLAVLFSGALLGLLAAQGTGNDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTT
  THRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNAT
  VHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRV
  MYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSY
  MAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAA
  QLPHTGVFGQSFSCPSDRSILLPLIIGLILLGLLALVLIAFCIIRRRPSAYQAL

• Sequence length: 354

Pathways

KEGG:

Lysosome

Reactome:

Neutrophil degranulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMYOTROPHIC LATERAL SCLEROSIS 1	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, PSORIATIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS, EXTRAHEPATIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERINSULINISM	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOTOR NEURON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	20454888		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	7803230		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	25971554, 30451398		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29628320, 29970512		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	29543850		★☆☆☆☆ Found in Text Mining only
Adrenal Hyperplasia Congenital	Congenital adrenal hyperplasia	Pubtator	34616364	Associate	★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	22044760		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	10782809		★☆☆☆☆ Found in Text Mining only
Alexander Disease	Alexander disease	Pubtator	25516918	Associate	★☆☆☆☆ Found in Text Mining only
Alveolar Soft Part Sarcoma	Alveolar Sarcoma	BEFREE	25268941, 30457206		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	30193587, 39930501	Associate	★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	27327904		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	30951849		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	22720079	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	28529876		★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	CTD_human_DG	11796754		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic lateral sclerosis 1	Amyotrophic lateral sclerosis	Pubtator	30215603	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	CTD_human_DG	11796754		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	CTD_human_DG	11796754		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	19661345		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	30659691		★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	36469034	Associate	★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	29100307		★☆☆☆☆ Found in Text Mining only
Angiomyolipoma of kidney	Angiomyolipoma Of Kidney	BEFREE	9630173		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	LHGDN	19165649		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26976451		★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	33237432	Associate	★☆☆☆☆ Found in Text Mining only
Anthracosis	Anterior uveitis	Pubtator	23717691	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	28561587		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	24997808, 25993291	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	22365948, 23241402, 24582702, 25993291		★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	34202072	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Stenosis Supravalvular	Aortic stenosis	Pubtator	32960096	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	12238639, 19363293, 21041949, 21293004, 27869795, 30921507, 31386895, 31621532		★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	21272347, 23006144, 35055107	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10857783, 14730603, 16207318, 17040961, 17613556, 23055831, 24314260, 27424032, 31320744	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	CTD_human_DG	19732956		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthropathy	Arthropathy	BEFREE	10782809		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11031340, 8630259, 8970374		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	19661345	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	12238639, 19363293, 21041949, 21293004, 27869795, 30921507, 31386895, 31621532		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	12238639, 22395501, 24036496, 27207962, 35202001	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	29420090	Inhibit	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	28225836		★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	9056541		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	32129578	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	25356944		★☆☆☆☆ Found in Text Mining only
Azoospermia Nonobstructive	Nonobstructive azoospermia	Pubtator	24895614	Stimulate	★☆☆☆☆ Found in Text Mining only
Azoospermia, Nonobstructive	Azoospermia	BEFREE	27709649		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	19661345		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	15128911	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	23162109		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	25487697	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29861872, 31056435		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	32974852, 40510346	Associate	★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	29220404		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18506688, 26391151, 26950462, 28574667, 29220404, 29936058, 29947077, 31035435, 31528120, 31837504		★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	36380012	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23300781, 26391151, 26979828, 27117582, 28029650, 28639912, 30558648, 32580398, 32799413, 32810665, 36598153, 36638208, 36946266	Associate	★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	30610800	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	38219446	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	21509527, 22467679, 29543850		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	24051699, 37194064	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	32313727	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	21980389, 22664550	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	26391151	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	27465886	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23555776, 28656201, 32165607, 33860125, 34092607, 34157683, 35202002, 35550532, 37370037, 39756577, 39838375	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of uterine cervix	Cervical Intraepithelial Neoplasia	BEFREE	10360812		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	29861872		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23227270, 29745083		★☆☆☆☆ Found in Text Mining only
Carcinoma of Male Breast	Breast Carcinoma, male	BEFREE	29743167		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	24797069, 27637082, 37649613, 40410886	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32313718, 35120484, 35550532, 35982911	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	18525219, 35550532	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	35928634	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	21980389, 22664550		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22322968, 25971554, 30803719		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	33988313	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	27301802, 28217949		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	32245320	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	19112034	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	28135035		★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	BEFREE	9056541		★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy, Hereditary	Cerebral Amyloid Angiopathy	BEFREE	9056541		★☆☆☆☆ Found in Text Mining only
Cerebral Aneurysm	Cerebral Aneurysm	BEFREE	25922506		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	26250788		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	11045675, 30439395		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	29151975		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	29151975		★☆☆☆☆ Found in Text Mining only
Cherubism	Cherubism	BEFREE	12787044, 30236129		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	33228682, 35317832, 36433731, 39359389	Associate	★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	29180269	Associate	★☆☆☆☆ Found in Text Mining only
Cholecystitis	Cholecystitis	Pubtator	24375043	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis, Extrahepatic	Cholestasis	CTD_human_DG	28789951		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chondrosarcoma	Chondrosarcoma	BEFREE	11704502		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	40514756	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	37300938	Associate	★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	19539174		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	26621103, 30280599		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	19074730		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	21197447, 22798194, 28557543		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	29234752		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	22531084		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	27256292	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	30243096	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22034888, 28928161, 29044503, 29209561, 29543850, 30202242, 30392787, 30523755, 30927925, 31182919, 31481956, 31650222		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23963148, 29543850, 30918427, 33818637, 34671130, 34964155, 36114487, 36611136	Associate	★☆☆☆☆ Found in Text Mining only
Compensatory Hyperinsulinemia	Compensatory Hyperinsulinemia	CTD_human_DG	29035695		★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	23162109		★☆☆☆☆ Found in Text Mining only
Congenital Dysplasia Of The Hip	Developmental dysplasia of the hip	BEFREE	30720141		★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of kidney	Renal hypoplasia	BEFREE	28185787		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	19343415		★☆☆☆☆ Found in Text Mining only
Conjunctival Diseases	Conjunctival disease	Pubtator	34697202	Stimulate	★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective tissue disease	Pubtator	32886246	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29023984, 29052596, 30738745		★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	39234691	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	23007990, 23009206		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	23007990, 27727089, 32245320	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	23009206, 26841679		★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	40721446	Associate	★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	28272106, 30399061, 30575644		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	10782809, 20112357, 21690378, 25631199, 28840952		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	29655167		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	27256292	Associate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	32917850, 34706460	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Allergic Contact	Allergic contact dermatitis	Pubtator	18798012	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	23414213		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	24286299, 35762881	Associate	★☆☆☆☆ Found in Text Mining only
Dermatomyositis, Childhood Type	Dermatomyositis	BEFREE	24286299		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	26873505, 28830301, 29619884, 30192315, 31622213		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	35390031, 38084523	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	21764240, 25899460, 38084523	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	26873505, 28830301, 29619884, 30192315, 31622213		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	26873505, 28454543, 30894181	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	36657987	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17009076, 21289263, 22314623, 27796420, 30356719, 30894181		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	24786705	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	27416772, 29331667, 31352855		★☆☆☆☆ Found in Text Mining only
Diastrophic dysplasia	Diastrophic dysplasia	Pubtator	27496082	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	31694577		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	35274685	Associate	★☆☆☆☆ Found in Text Mining only
Dyspepsia	Dysphasia	Pubtator	36264979	Inhibit	★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	24375043	Stimulate	★☆☆☆☆ Found in Text Mining only
Ectrodactyly	Ectrodactyly	Pubtator	35687294	Stimulate	★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	23122929		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	23414213		★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	28072884		★☆☆☆☆ Found in Text Mining only
Endogenous Hyperinsulinism	Endogenous Hyperinsulinism	CTD_human_DG	29035695		★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	17574772		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	26744532		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	29264987	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	12161505, 28950844, 30567635		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	15602080, 15831511, 22555803		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	17548071	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	30845295, 35628423	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	30194729		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	25971554		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	9630173		★☆☆☆☆ Found in Text Mining only
Erdheim-Chester Disease	Erdheim-Chester Disease	BEFREE	26197238, 27196481, 28182116, 30474563		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	22134872	Associate	★☆☆☆☆ Found in Text Mining only
Exogenous Hyperinsulinism	Exogenous Hyperinsulinism	CTD_human_DG	29035695		★☆☆☆☆ Found in Text Mining only
Familial Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	BEFREE	9056541		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	28830983		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	28830983		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	29581157		★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	31337151	Inhibit	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	22363403, 28306139, 31337151		★☆☆☆☆ Found in Text Mining only
Fibrolamellar Hepatocellular Carcinoma	Hepatocellular Carcinoma	BEFREE	28110996		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	22531084		★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	26875556		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	26875556		★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	28830983		★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	21751146	Associate	★☆☆☆☆ Found in Text Mining only
Gallstones	Gallstones	Pubtator	24375043	Associate	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	28801853, 30813210		★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	30813210		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	18334877, 29721368		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	25120735	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	16218934, 29890162, 30799840		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	35003111	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29062041, 30367810, 30377570, 31701625		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30299157, 35550532	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22098621, 29062041, 30086759, 30367810, 30377570		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19661345, 29286116, 30568502		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	19661345, 28789475, 33371165, 34645618, 35316217, 35550532	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	25026899	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	33389462	Stimulate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	29924048		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	8025214	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	32176314	Associate	★☆☆☆☆ Found in Text Mining only
Hallopeau-Siemens Disease	DYSTROPHIC EPIDERMOLYSIS BULLOSA	BEFREE	31692111		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	25356944, 29924048		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	29924048	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	39619326	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	38379280, 39337571	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	19343415		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	12483012	Associate	★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	BEFREE	12663233		★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	30160169		★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	27183637	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	26919045	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	29921328	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	31260499	Stimulate	★☆☆☆☆ Found in Text Mining only
Histiocytoma Angiomatoid Fibrous	Angiomatoid fibrous histiocytoma	Pubtator	26261484	Associate	★☆☆☆☆ Found in Text Mining only
Histiocytosis	Histiocytosis	BEFREE	29341328		★☆☆☆☆ Found in Text Mining only
Histiocytosis with joint contractures and sensorineural deafness	Histiocytosis With Joint Contractures And Sensorineural Deafness	BEFREE	21178579		★☆☆☆☆ Found in Text Mining only
Histiocytosis, Langerhans-Cell	Histiocytosis	BEFREE	24532298, 29341328		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	1320954, 22044760		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	21071500, 21602260, 22289504, 22948049, 23045593, 25978381, 31714922, 32019558, 33558066	Associate	★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	27744503		★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	15165671		★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	BEFREE	31056435		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	23326634, 28173800		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30972941		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	CTD_human_DG	29035695		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipidemia	Hyperlipidemia	BEFREE	17043800		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29346014, 30280796		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	28133606, 31658321		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	18371555	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36093941	Inhibit	★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	30999901		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	22037258, 32213567	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29507864		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	14767014, 30303541, 8544410		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	31670229		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	19155972, 28093272, 29538651, 30160169		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	12137866	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	23448791, 24301659, 29023984, 29970500		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	23573303, 24301659	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	28422766, 29858753		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	18270300	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	21197447, 26871994	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intracranial Arteriovenous Malformations	Intracranial arteriovenous malformation	Pubtator	20881566	Associate	★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	27924463		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	28919993		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	28574667		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	31097447		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	24301659		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	11378558		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	31535918, 34459751, 38255818	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	19539174		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	CTD_human_DG	19539174		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	22800829		★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	18316565		★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	LHGDN	18316565		★☆☆☆☆ Found in Text Mining only
Leishmaniasis	Leishmaniasis	Pubtator	23440109	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	19074730		★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	24903677	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Accelerated Phase	Myeloid leukemia	Pubtator	27999815	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	29720577	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	17041567		★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	27793032		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	40532443	Associate	★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	26315114		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	18430964, 21251185		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	Pubtator	18430964	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25007179, 26938527, 28110996, 28656201, 29731831, 29921949, 31116889, 31296243		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	22531084		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	33589523	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	16287509	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	23227270		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	29745083, 32245320	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	35762881, 39290707	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	26621103		★☆☆☆☆ Found in Text Mining only
Lymphadenitis	Lymphadenitis	BEFREE	26463422		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	26391151, 27510849		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26391151, 29434448, 29745083, 36372883, 36433731	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	26463422		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	31273513, 35816682	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	18174380, 28733197		★☆☆☆☆ Found in Text Mining only
Malignant granular cell tumor	Granular Cell Tumor	BEFREE	29847320		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18506688, 26391151, 26950462, 28574667, 29220404, 29936058, 29947077, 30368555, 31035435, 31528120, 31837504		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	26744532		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23227270, 29745083		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	26315114, 30652402		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	22322968, 30803719		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25557640, 30092175		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22034888		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26714314, 28791370, 28819379, 29616104, 31521128		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	30659691		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29861872		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22563438, 23227270, 24883329, 25483261, 29163797, 29731831, 30568502, 31711773		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	12237887		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	29151975		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	20664940		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	29220404, 29921315, 30524905		★☆☆☆☆ Found in Text Mining only
Mediastinal Germ Cell Tumor	Mediastinal Tumor	BEFREE	16809892		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	20811059, 30399061, 30575644		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	24051699, 29054599, 30459241, 37562584	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	33009490	Inhibit	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	11131990, 29427150		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	28191624	Associate	★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	28465247		★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	22467679		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	15372243		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	23007990	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	23007990		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	23951013	Associate	★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	27988845		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	38255860	Associate	★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	39290707	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	28467980, 28505365, 31621532		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10029574		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10029574	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	37170758	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	17079667, 21241398, 23000427, 24397908, 26250788, 27988845, 28601280, 9987758		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	31857644, 37715818	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	30451963		★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	32556361	Stimulate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	10374872		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	37366304	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	17041567		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	27914007, 29179985		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	30894181		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	30894181	Associate	★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	12498225, 31534205		★☆☆☆☆ Found in Text Mining only
Myopathies Nemaline	Nemaline myopathy	Pubtator	34043258	Associate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	21904631	Associate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	31443116		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	11182013, 23541322, 25361058	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	16358608, 20214821, 21943944, 23541322		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	22745579	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28877959, 31522611		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	25516918, 30423808	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10702399, 11011118, 11857488, 14508834, 15067327, 15948236, 16614946, 17513794, 18283317, 18316565, 19661345, 19951991, 20379224, 21359545, 21822305, 22146489, 22467679, 22563438, 22664550, 22743317, 22895265, 23206928, 24421272, 25267378, 25538263, 25644184, 26068398, 26342691, 26391151, 26714314, 27058895, 27105526, 27117582, 27322955, 27327904, 27425378, 28030864, 28043912, 28073370, 28076333, 28292827, 28422766, 28508176, 28553668, 28655639, 28656201, 29044503, 29100307, 29158842, 29220404, 29302887, 29427150, 29516164, 29541395, 29616104, 29628320, 29744662, 29898754, 29936058, 30026826, 30092175, 30106758, 30141009, 30229370, 30275231, 30311406, 30399061, 30430204, 30619287, 30735815, 30737470, 30813210, 30885349, 30941232, 31035013, 31296243, 31517495, 31615933, 31618252, 31677179, 31720917, 31754048, 31755915, 31811434, 31831392, 7829236		★☆☆☆☆ Found in Text Mining only
Nephritis, Interstitial	Nephritis	BEFREE	31240503		★☆☆☆☆ Found in Text Mining only
Nephritis, Tubulointerstitial	Nephritis	BEFREE	31240503		★☆☆☆☆ Found in Text Mining only
Nephrosclerosis	Nephrosclerosis	Pubtator	22129502	Stimulate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	35173708	Associate	★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	17763329		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	29117601, 29427150		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	27425378		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	26250788		★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	18410276, 21241398		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28323124, 30470953		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29745083, 30089583, 30334403, 30610087, 31843013		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	16608891, 17456576, 18057090, 18262644, 30356719		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	18262644, 19249917, 31320744, 34725292	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	22836687, 28454543	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	29035695		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	29035695	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity, Morbid	Obesity	BEFREE	31554917		★☆☆☆☆ Found in Text Mining only
Obstructive azoospermia	Obstructive azoospermia	BEFREE	27709649		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	17613556, 27424032	Associate	★☆☆☆☆ Found in Text Mining only
Osteolysis	Osteolysis	Pubtator	27196532	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	30803719		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	22322968		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26541760, 30803719, 32249277, 35186171	Associate	★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	31545822		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25557640, 30092175		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25557640, 32051287	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	29079517		★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	32053120, 36264979	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Acute Necrotizing	Necrotizing pancreatitis	BEFREE	29079517, 31037357		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	22870901		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	29243545		★☆☆☆☆ Found in Text Mining only
Parathyroid Gland Adenocarcinoma	Parathyroid Gland Adenocarcinoma	BEFREE	30033186		★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid Neoplasms	BEFREE	30033186		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	28370244		★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical periodontitis	Pubtator	18926740	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	30298589, 31032945		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	35888586	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	17577022		★☆☆☆☆ Found in Text Mining only
Perivascular Epithelioid Cell Neoplasms	Perivascular Epithelioid Neoplasms	BEFREE	29052596, 29516164		★☆☆☆☆ Found in Text Mining only
Plexiform Neurofibroma	Plexiform neurofibroma	BEFREE	29427150		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	22945299		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	27196481		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	31443116		★☆☆☆☆ Found in Text Mining only
Polyneuropathy	Polyneuropathy	BEFREE	28114358		★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	28508176		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	29180269		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	22470535		★☆☆☆☆ Found in Text Mining only
Prune Belly Syndrome	Prune belly syndrome	BEFREE	31545822		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	16645593, 20555352, 29182760	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	29182760		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	32245320, 32915645	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Eosinophilia	Pulmonary Eosinophilia	BEFREE	19494526		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24327013, 29023984, 29052596, 30156770		★☆☆☆☆ Found in Text Mining only
Renal tubular disorder	Renal Tubular Disorder	BEFREE	29245956		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	30420790		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	30193587	Inhibit	★☆☆☆☆ Found in Text Mining only
Retinoschisis	Retinoschisis	Pubtator	33601057	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11285370, 11508579, 12571844, 15288002, 16134726, 17625943, 19660107, 20112357, 21690378, 23490466, 24725539, 2472638, 25289668, 26658436		★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	BEFREE	10543283		★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	Pubtator	10543283	Associate	★☆☆☆☆ Found in Text Mining only
Sacroiliitis	Sacroiliitis	BEFREE	29884210		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	29107084		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	1471748, 30999901		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	32313727	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Alveolar Soft Part	Sarcoma	Pubtator	35628499	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	25487697, 30630651	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	30630651		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	34504485	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	33104706	Associate	★☆☆☆☆ Found in Text Mining only
Sinus histiocytosis	Sinus Histiocytosis	BEFREE	28836691, 30296195		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	25902739	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	27207443	Stimulate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	34669971	Associate	★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	11285370		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	23414213		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	32020899	Associate	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	36705391	Associate	★☆☆☆☆ Found in Text Mining only
Split hand foot deformity 1	Split hand foot deformity	BEFREE	23597965, 24532298, 25454479		★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	27784336		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	12237887, 28122336, 29151975		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29885401		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	17378915, 24883329, 28052009, 28122336, 29284429, 31744214, 32035062, 33307825	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lip	Carcinoma of Lip	BEFREE	18525219		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	30652402		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	29479687, 31692111		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	29506555, 29541395, 31109698		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	27708340, 29581157, 31337151		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	30999901		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28791370, 28819379, 29616104, 31521128		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28791370, 33457080, 37432407, 38358183	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29434448	Stimulate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	31433571		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	18460022		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	27044395	Stimulate	★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	29312834		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	31320744	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	16014681, 29669578		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	12409611		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	36064651	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	18284633		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	22870901	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	30659691		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	34184083	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	26875556		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	30659691		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	35550532	Associate	★☆☆☆☆ Found in Text Mining only
Tonsillitis	Tonsillitis	Pubtator	12116363	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26752006, 29921315, 34732817	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29921315		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	21425209, 21441812, 28426456		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	26197470	Associate	★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	BEFREE	19170891, 22797933		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	34919260	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33087896, 37109686, 39201801	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	15113392, 19369244, 33203661	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	20811059, 22743317		★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular Fibrillation	BEFREE	20219395		★☆☆☆☆ Found in Text Mining only
Waardenburg Anophthalmia Syndrome	Microphthalmia with limb anomalies	BEFREE	25631199		★☆☆☆☆ Found in Text Mining only
Williams Syndrome	Williams syndrome	Pubtator	32960096	Stimulate	★☆☆☆☆ Found in Text Mining only