Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	9678
Gene name	PHD finger protein 14
Gene symbol	PHF14
Synonyms (NCBI Gene)	-
Chromosome	7
Chromosome location	7p21.3

273

Show/Hide all (273)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020981	hsa-miR-155-5p	Reporter assay;Other	20584899
MIRT022055	hsa-miR-128-3p	Microarray	17612493
MIRT023375	hsa-miR-122-5p	Microarray	17612493
MIRT047036	hsa-miR-183-5p	CLASH	23622248
MIRT444900	hsa-miR-200b-3p	PAR-CLIP	22291592
MIRT444899	hsa-miR-200c-3p	PAR-CLIP	22291592
MIRT444898	hsa-miR-429	PAR-CLIP	22291592
MIRT444897	hsa-miR-3613-3p	PAR-CLIP	22291592
MIRT444896	hsa-miR-4635	PAR-CLIP	22291592
MIRT444895	hsa-miR-4474-5p	PAR-CLIP	22291592
MIRT444894	hsa-miR-5585-3p	PAR-CLIP	22291592
MIRT444900	hsa-miR-200b-3p	PAR-CLIP	22100165
MIRT444899	hsa-miR-200c-3p	PAR-CLIP	22100165
MIRT444898	hsa-miR-429	PAR-CLIP	22100165
MIRT444897	hsa-miR-3613-3p	PAR-CLIP	22100165
MIRT444896	hsa-miR-4635	PAR-CLIP	22100165
MIRT444895	hsa-miR-4474-5p	PAR-CLIP	22100165
MIRT444894	hsa-miR-5585-3p	PAR-CLIP	22100165
MIRT444900	hsa-miR-200b-3p	PAR-CLIP	22100165
MIRT444899	hsa-miR-200c-3p	PAR-CLIP	22100165
MIRT444898	hsa-miR-429	PAR-CLIP	22100165
MIRT444897	hsa-miR-3613-3p	PAR-CLIP	22100165
MIRT444896	hsa-miR-4635	PAR-CLIP	22100165
MIRT444895	hsa-miR-4474-5p	PAR-CLIP	22100165
MIRT444894	hsa-miR-5585-3p	PAR-CLIP	22100165
MIRT444900	hsa-miR-200b-3p	PAR-CLIP	22291592
MIRT444899	hsa-miR-200c-3p	PAR-CLIP	22291592
MIRT444898	hsa-miR-429	PAR-CLIP	22291592
MIRT444897	hsa-miR-3613-3p	PAR-CLIP	22291592
MIRT444896	hsa-miR-4635	PAR-CLIP	22291592
MIRT444895	hsa-miR-4474-5p	PAR-CLIP	22291592
MIRT444894	hsa-miR-5585-3p	PAR-CLIP	22291592
MIRT444900	hsa-miR-200b-3p	PAR-CLIP	22100165
MIRT444899	hsa-miR-200c-3p	PAR-CLIP	22100165
MIRT444898	hsa-miR-429	PAR-CLIP	22100165
MIRT444897	hsa-miR-3613-3p	PAR-CLIP	22100165
MIRT444896	hsa-miR-4635	PAR-CLIP	22100165
MIRT444895	hsa-miR-4474-5p	PAR-CLIP	22100165
MIRT444894	hsa-miR-5585-3p	PAR-CLIP	22100165
MIRT444900	hsa-miR-200b-3p	PAR-CLIP	22100165
MIRT444899	hsa-miR-200c-3p	PAR-CLIP	22100165
MIRT444898	hsa-miR-429	PAR-CLIP	22100165
MIRT444897	hsa-miR-3613-3p	PAR-CLIP	22100165
MIRT444896	hsa-miR-4635	PAR-CLIP	22100165
MIRT444895	hsa-miR-4474-5p	PAR-CLIP	22100165
MIRT444894	hsa-miR-5585-3p	PAR-CLIP	22100165
MIRT1230132	hsa-miR-1180	CLIP-seq
MIRT1230133	hsa-miR-1207-3p	CLIP-seq
MIRT1230134	hsa-miR-1255a	CLIP-seq
MIRT1230135	hsa-miR-1255b	CLIP-seq
MIRT1230136	hsa-miR-146a	CLIP-seq
MIRT1230137	hsa-miR-146b-5p	CLIP-seq
MIRT1230138	hsa-miR-1914	CLIP-seq
MIRT1230139	hsa-miR-21	CLIP-seq
MIRT1230140	hsa-miR-219-2-3p	CLIP-seq
MIRT1230141	hsa-miR-2964a-3p	CLIP-seq
MIRT1230142	hsa-miR-3148	CLIP-seq
MIRT1230143	hsa-miR-3152-5p	CLIP-seq
MIRT1230144	hsa-miR-3156-5p	CLIP-seq
MIRT1230145	hsa-miR-3163	CLIP-seq
MIRT1230146	hsa-miR-3173-3p	CLIP-seq
MIRT1230147	hsa-miR-340	CLIP-seq
MIRT1230148	hsa-miR-3605-5p	CLIP-seq
MIRT1230149	hsa-miR-361-5p	CLIP-seq
MIRT1230150	hsa-miR-3622a-3p	CLIP-seq
MIRT1230151	hsa-miR-3622b-3p	CLIP-seq
MIRT1230152	hsa-miR-3649	CLIP-seq
MIRT1230153	hsa-miR-3662	CLIP-seq
MIRT1230154	hsa-miR-3667-3p	CLIP-seq
MIRT1230155	hsa-miR-3919	CLIP-seq
MIRT1230156	hsa-miR-3924	CLIP-seq
MIRT1230157	hsa-miR-3942-3p	CLIP-seq
MIRT1230158	hsa-miR-3973	CLIP-seq
MIRT1230159	hsa-miR-4428	CLIP-seq
MIRT1230160	hsa-miR-4477b	CLIP-seq
MIRT1230161	hsa-miR-4495	CLIP-seq
MIRT1230162	hsa-miR-4497	CLIP-seq
MIRT1230163	hsa-miR-450b-5p	CLIP-seq
MIRT1230164	hsa-miR-4652-3p	CLIP-seq
MIRT1230165	hsa-miR-4662a-3p	CLIP-seq
MIRT1230166	hsa-miR-4664-3p	CLIP-seq
MIRT1230167	hsa-miR-4668-3p	CLIP-seq
MIRT1230168	hsa-miR-4668-5p	CLIP-seq
MIRT1230169	hsa-miR-4679	CLIP-seq
MIRT1230170	hsa-miR-4699-5p	CLIP-seq
MIRT1230171	hsa-miR-4712-3p	CLIP-seq
MIRT1230172	hsa-miR-4733-5p	CLIP-seq
MIRT1230173	hsa-miR-4742-3p	CLIP-seq
MIRT1230174	hsa-miR-4756-3p	CLIP-seq
MIRT1230175	hsa-miR-4765	CLIP-seq
MIRT1230176	hsa-miR-4796-5p	CLIP-seq
MIRT1230177	hsa-miR-486-5p	CLIP-seq
MIRT1230178	hsa-miR-495	CLIP-seq
MIRT1230179	hsa-miR-500a	CLIP-seq
MIRT1230180	hsa-miR-507	CLIP-seq
MIRT1230181	hsa-miR-520d-5p	CLIP-seq
MIRT1230182	hsa-miR-522	CLIP-seq
MIRT1230183	hsa-miR-524-5p	CLIP-seq
MIRT1230184	hsa-miR-548c-3p	CLIP-seq
MIRT1230185	hsa-miR-557	CLIP-seq
MIRT1230186	hsa-miR-562	CLIP-seq
MIRT1230187	hsa-miR-568	CLIP-seq
MIRT1230188	hsa-miR-576-3p	CLIP-seq
MIRT1230189	hsa-miR-577	CLIP-seq
MIRT1230190	hsa-miR-580	CLIP-seq
MIRT1230191	hsa-miR-583	CLIP-seq
MIRT1230192	hsa-miR-589	CLIP-seq
MIRT1230193	hsa-miR-590-5p	CLIP-seq
MIRT1230194	hsa-miR-889	CLIP-seq
MIRT1920762	hsa-miR-518d-5p	CLIP-seq
MIRT1920763	hsa-miR-519b-5p	CLIP-seq
MIRT1920764	hsa-miR-519c-5p	CLIP-seq
MIRT1920765	hsa-miR-520c-5p	CLIP-seq
MIRT1920766	hsa-miR-526a	CLIP-seq
MIRT1920762	hsa-miR-518d-5p	CLIP-seq
MIRT1920763	hsa-miR-519b-5p	CLIP-seq
MIRT1920764	hsa-miR-519c-5p	CLIP-seq
MIRT1920765	hsa-miR-520c-5p	CLIP-seq
MIRT1920766	hsa-miR-526a	CLIP-seq
MIRT1920762	hsa-miR-518d-5p	CLIP-seq
MIRT1920763	hsa-miR-519b-5p	CLIP-seq
MIRT1920764	hsa-miR-519c-5p	CLIP-seq
MIRT1920765	hsa-miR-520c-5p	CLIP-seq
MIRT1920766	hsa-miR-526a	CLIP-seq
MIRT2067407	hsa-miR-106a	CLIP-seq
MIRT2067408	hsa-miR-106b	CLIP-seq
MIRT2067409	hsa-miR-1279	CLIP-seq
MIRT2067410	hsa-miR-17	CLIP-seq
MIRT2067411	hsa-miR-188-3p	CLIP-seq
MIRT2067412	hsa-miR-20a	CLIP-seq
MIRT2067413	hsa-miR-20b	CLIP-seq
MIRT2067414	hsa-miR-216a	CLIP-seq
MIRT2067415	hsa-miR-2467-3p	CLIP-seq
MIRT2067416	hsa-miR-3125	CLIP-seq
MIRT2067417	hsa-miR-3149	CLIP-seq
MIRT2067418	hsa-miR-3153	CLIP-seq
MIRT1230145	hsa-miR-3163	CLIP-seq
MIRT2067419	hsa-miR-3179	CLIP-seq
MIRT2067420	hsa-miR-323-3p	CLIP-seq
MIRT2067421	hsa-miR-3609	CLIP-seq
MIRT2067422	hsa-miR-3616-3p	CLIP-seq
MIRT2067423	hsa-miR-3617	CLIP-seq
MIRT2067424	hsa-miR-3916	CLIP-seq
MIRT2067425	hsa-miR-4270	CLIP-seq
MIRT2067426	hsa-miR-4291	CLIP-seq
MIRT2067427	hsa-miR-4419a	CLIP-seq
MIRT2067428	hsa-miR-4436b-3p	CLIP-seq
MIRT2067429	hsa-miR-4438	CLIP-seq
MIRT2067430	hsa-miR-4441	CLIP-seq
MIRT2067431	hsa-miR-4477a	CLIP-seq
MIRT2067432	hsa-miR-4503	CLIP-seq
MIRT1230163	hsa-miR-450b-5p	CLIP-seq
MIRT2067433	hsa-miR-4510	CLIP-seq
MIRT2067434	hsa-miR-451b	CLIP-seq
MIRT1230167	hsa-miR-4668-3p	CLIP-seq
MIRT2067435	hsa-miR-4705	CLIP-seq
MIRT2067436	hsa-miR-4709-5p	CLIP-seq
MIRT2067437	hsa-miR-4716-3p	CLIP-seq
MIRT2067438	hsa-miR-4723-5p	CLIP-seq
MIRT2067439	hsa-miR-4728-5p	CLIP-seq
MIRT2067440	hsa-miR-4768-3p	CLIP-seq
MIRT2067441	hsa-miR-4796-3p	CLIP-seq
MIRT1230176	hsa-miR-4796-5p	CLIP-seq
MIRT1230180	hsa-miR-507	CLIP-seq
MIRT2067442	hsa-miR-519d	CLIP-seq
MIRT1230181	hsa-miR-520d-5p	CLIP-seq
MIRT1230183	hsa-miR-524-5p	CLIP-seq
MIRT2067443	hsa-miR-545	CLIP-seq
MIRT2067444	hsa-miR-548ae	CLIP-seq
MIRT2067445	hsa-miR-548ah	CLIP-seq
MIRT2067446	hsa-miR-548aj	CLIP-seq
MIRT2067447	hsa-miR-548am	CLIP-seq
MIRT2067448	hsa-miR-548x	CLIP-seq
MIRT2067449	hsa-miR-556-5p	CLIP-seq
MIRT1230185	hsa-miR-557	CLIP-seq
MIRT1230187	hsa-miR-568	CLIP-seq
MIRT1230191	hsa-miR-583	CLIP-seq
MIRT2067450	hsa-miR-587	CLIP-seq
MIRT2067451	hsa-miR-618	CLIP-seq
MIRT2067452	hsa-miR-641	CLIP-seq
MIRT2067453	hsa-miR-665	CLIP-seq
MIRT2067454	hsa-miR-93	CLIP-seq
MIRT2067407	hsa-miR-106a	CLIP-seq
MIRT2067408	hsa-miR-106b	CLIP-seq
MIRT2294984	hsa-miR-1245b-3p	CLIP-seq
MIRT2067409	hsa-miR-1279	CLIP-seq
MIRT2294985	hsa-miR-129-5p	CLIP-seq
MIRT2294986	hsa-miR-1305	CLIP-seq
MIRT2294987	hsa-miR-141	CLIP-seq
MIRT2067410	hsa-miR-17	CLIP-seq
MIRT2294988	hsa-miR-200a	CLIP-seq
MIRT2067412	hsa-miR-20a	CLIP-seq
MIRT2067413	hsa-miR-20b	CLIP-seq
MIRT1230139	hsa-miR-21	CLIP-seq
MIRT2067414	hsa-miR-216a	CLIP-seq
MIRT2294989	hsa-miR-224	CLIP-seq
MIRT2067415	hsa-miR-2467-3p	CLIP-seq
MIRT2294990	hsa-miR-297	CLIP-seq
MIRT2294991	hsa-miR-3065-5p	CLIP-seq
MIRT2294992	hsa-miR-3117-3p	CLIP-seq
MIRT1230145	hsa-miR-3163	CLIP-seq
MIRT2294993	hsa-miR-3169	CLIP-seq
MIRT2067419	hsa-miR-3179	CLIP-seq
MIRT2067421	hsa-miR-3609	CLIP-seq
MIRT2067422	hsa-miR-3616-3p	CLIP-seq
MIRT2294994	hsa-miR-3647-3p	CLIP-seq
MIRT1230154	hsa-miR-3667-3p	CLIP-seq
MIRT2294995	hsa-miR-3685	CLIP-seq
MIRT2294996	hsa-miR-380	CLIP-seq
MIRT2294997	hsa-miR-384	CLIP-seq
MIRT1230156	hsa-miR-3924	CLIP-seq
MIRT2294998	hsa-miR-421	CLIP-seq
MIRT2067425	hsa-miR-4270	CLIP-seq
MIRT2294999	hsa-miR-4275	CLIP-seq
MIRT2067426	hsa-miR-4291	CLIP-seq
MIRT2295000	hsa-miR-4307	CLIP-seq
MIRT2067427	hsa-miR-4419a	CLIP-seq
MIRT2067428	hsa-miR-4436b-3p	CLIP-seq
MIRT2295001	hsa-miR-4436b-5p	CLIP-seq
MIRT2067429	hsa-miR-4438	CLIP-seq
MIRT2067430	hsa-miR-4441	CLIP-seq
MIRT2295002	hsa-miR-4457	CLIP-seq
MIRT2067431	hsa-miR-4477a	CLIP-seq
MIRT1230161	hsa-miR-4495	CLIP-seq
MIRT2067432	hsa-miR-4503	CLIP-seq
MIRT2295003	hsa-miR-4504	CLIP-seq
MIRT1230163	hsa-miR-450b-5p	CLIP-seq
MIRT2067433	hsa-miR-4510	CLIP-seq
MIRT1230164	hsa-miR-4652-3p	CLIP-seq
MIRT1230167	hsa-miR-4668-3p	CLIP-seq
MIRT1230169	hsa-miR-4679	CLIP-seq
MIRT2295004	hsa-miR-4685-5p	CLIP-seq
MIRT2067435	hsa-miR-4705	CLIP-seq
MIRT2067437	hsa-miR-4716-3p	CLIP-seq
MIRT2295005	hsa-miR-4720-3p	CLIP-seq
MIRT2067438	hsa-miR-4723-5p	CLIP-seq
MIRT2067439	hsa-miR-4728-5p	CLIP-seq
MIRT2295006	hsa-miR-4759	CLIP-seq
MIRT2295007	hsa-miR-4776-3p	CLIP-seq
MIRT2067441	hsa-miR-4796-3p	CLIP-seq
MIRT1230176	hsa-miR-4796-5p	CLIP-seq
MIRT2295008	hsa-miR-4804-3p	CLIP-seq
MIRT1230180	hsa-miR-507	CLIP-seq
MIRT2295009	hsa-miR-508-5p	CLIP-seq
MIRT2295010	hsa-miR-513b	CLIP-seq
MIRT2067442	hsa-miR-519d	CLIP-seq
MIRT2067443	hsa-miR-545	CLIP-seq
MIRT2067445	hsa-miR-548ah	CLIP-seq
MIRT1230184	hsa-miR-548c-3p	CLIP-seq
MIRT1230185	hsa-miR-557	CLIP-seq
MIRT2295011	hsa-miR-567	CLIP-seq
MIRT2295012	hsa-miR-579	CLIP-seq
MIRT1230193	hsa-miR-590-5p	CLIP-seq
MIRT2295013	hsa-miR-616	CLIP-seq
MIRT2295014	hsa-miR-891b	CLIP-seq
MIRT2295015	hsa-miR-892a	CLIP-seq
MIRT2067454	hsa-miR-93	CLIP-seq
MIRT2295013	hsa-miR-616	CLIP-seq
MIRT2294985	hsa-miR-129-5p	CLIP-seq
MIRT1230139	hsa-miR-21	CLIP-seq
MIRT2592733	hsa-miR-2117	CLIP-seq
MIRT2592734	hsa-miR-338-5p	CLIP-seq
MIRT2592735	hsa-miR-4273	CLIP-seq
MIRT2592736	hsa-miR-4279	CLIP-seq
MIRT2295003	hsa-miR-4504	CLIP-seq
MIRT1230163	hsa-miR-450b-5p	CLIP-seq
MIRT1230180	hsa-miR-507	CLIP-seq
MIRT2592737	hsa-miR-548an	CLIP-seq
MIRT2592738	hsa-miR-548p	CLIP-seq
MIRT1230185	hsa-miR-557	CLIP-seq
MIRT1230193	hsa-miR-590-5p	CLIP-seq
MIRT2295014	hsa-miR-891b	CLIP-seq
MIRT2592738	hsa-miR-548p	CLIP-seq

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000785	Component	Chromatin	IDA	23688586
GO:0002314	Process	Germinal center B cell differentiation	IEA
GO:0002314	Process	Germinal center B cell differentiation	ISS
GO:0005515	Function	Protein binding	IPI	28160558
GO:0005634	Component	Nucleus	IDA	23688586
GO:0005634	Component	Nucleus	IEA
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IDA	23688586
GO:0005737	Component	Cytoplasm	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	ISS
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	ISS
GO:0010463	Process	Mesenchymal cell proliferation	IEA
GO:0010463	Process	Mesenchymal cell proliferation	ISS
GO:0042393	Function	Histone binding	IDA	23688586
GO:0046872	Function	Metal ion binding	IEA
GO:0048286	Process	Lung alveolus development	IEA
GO:0048286	Process	Lung alveolus development	ISS
GO:0060916	Process	Mesenchymal cell proliferation involved in lung development	IEA
GO:0060916	Process	Mesenchymal cell proliferation involved in lung development	ISS
GO:0072201	Process	Negative regulation of mesenchymal cell proliferation	IEA
GO:0072201	Process	Negative regulation of mesenchymal cell proliferation	ISS
GO:0140566	Function	Histone reader activity	ISS
GO:2000584	Process	Negative regulation of platelet-derived growth factor receptor-alpha signaling pathway	IEA
GO:2000584	Process	Negative regulation of platelet-derived growth factor receptor-alpha signaling pathway	ISS
GO:2000791	Process	Negative regulation of mesenchymal cell proliferation involved in lung development	IEA
GO:2000791	Process	Negative regulation of mesenchymal cell proliferation involved in lung development	ISS

MIM	HGNC	e!Ensembl
619907	22203	ENSG00000106443

O94880

Protein name

PHD finger protein 14

Protein function

Histone-binding protein (PubMed:23688586). Binds preferentially to unmodified histone H3 but can also bind to a lesser extent to histone H3 trimethylated at 'Lys-9' (H3K9me3) as well as to histone H3 monomethylated at 'Lys-27' (H3K27ac) and trim

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00628	PHD	321 → 380	PHD-finger	Domain
PF13832	zf-HC5HC2H_2	383 → 498		Domain
PF00628	PHD	727 → 779	PHD-finger	Domain

Sequence

MDRSSKRRQVKPLAASLLEALDYDSSDDSDFKVGDASDSEGSGNGSEDASKDSGEGSCSD
SEENILEEELNEDIKVKEEQLKNSAEEEVLSSEKQLIKMEKKEEEENGERPRKKKEKEKE
KEKEKEKEKEREKEKEKATVSENVAASAAATTPATSPPAVNTSPSVPTTTTATEEQVSEP
KKWNLRRNRPLLDFVSMEELNDMDDYDSEDDNDWRPTVVKRKGRSASQKEGSDGDNEDDE
DEGSGSDEDENDEGNDEDHSSPASEGGCKKKKSKVLSRNSADDEELTNDSLTLSQSKSNE
DSLILEKSQNWSSQKMDHILICCVCLGDNSEDADEIIQCDNCGITVHEGCYGVDGESDSI
MSSASENSTEPWFCDACKCGVSPSCELCPNQDGIFKETDAGRWVHIVCALYVPGVAFGDI
DKLRPVTLTEMNYSKYGAKECSFCEDPRFARTGVCISCDAGMCRAYFHVTCAQKEGLLSE
AAAEEDIADPFFAYCKQHADRLDRKWKRKNYLALQSYCKMSLQEREKQLSPEAQARINAR
LQQYRAKAELARSTRPQAWVPREKLPRPLTSSASAIRKLMRKAELMGISTDIFPVDNSDT
SSSVDGRRKHKQPALTADFVNYYFERNMRMIQIQENMAEQKNIKDKLENEQEKLHVEYNK
LCESLEELQNLNGKLRSEGQGIWALLGRITGQKLNIPAILRAPKERKPSKKEGGTQKTST
LPAVLYSCGICKKNHDQHLLLLCDTCKLHYHLGCLDPPLTRMPRKTKNSYWQCSECDQAG
SSDMEADMAMETLPDGTKRSRRQIKEPVKFVPQDVPPEPKKIPIRNTRTRGRKRSFVPEE
EKHEERVPRERRQRQSVLQKKPKAEDLRTECATCKGTGDNENLVRYPS

Sequence length

888

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (30)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	28160558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	26830138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30915882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30915882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	30915882	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30940184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30940184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28160558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Diseases	Cerebellar Diseases	BEFREE	22617776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	GWASDB_DG	23422753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	GWASCAT_DG	30373671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	31040906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	28814329	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dandy-Walker Syndrome	Dandy-Walker Syndrome	BEFREE	22617776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	37768180	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31798343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31798343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	31798343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	26866982	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	28814329	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	26866982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	30915882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	30915882	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28160558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	31040906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30940184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	31040906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31798343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	28045076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	23688586		★★★★★ ★☆☆☆☆ Found in Text Mining only

PHF14 (PHD finger protein 14)