CD63 (CD63 molecule)

Gene

• Entrez ID: 967
• Gene name: CD63 molecule
• Gene symbol: CD63
• Synonyms (NCBI Gene): AD1, HOP-26, ME491, MLA1, OMA81H, Pltgp40, TSPAN30
• Chromosome: 12
• Chromosome location: 12q13.2
• Summary: The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023517	hsa-miR-1-3p	Proteomics	18668040
MIRT052897	hsa-miR-3943	CLASH	23622248
MIRT525497	hsa-miR-6890-3p	PAR-CLIP	22012620
MIRT525496	hsa-miR-1273g-3p	PAR-CLIP	22012620
MIRT525495	hsa-miR-4763-5p	PAR-CLIP	22012620
MIRT525494	hsa-miR-6894-3p	PAR-CLIP	22012620
MIRT732764	hsa-miR-483-5p	RNA-seq	33833530
MIRT732765	hsa-miR-342-5p	RNA-seq	33833530
MIRT525497	hsa-miR-6890-3p	PAR-CLIP	22012620
MIRT525496	hsa-miR-1273g-3p	PAR-CLIP	22012620
MIRT525495	hsa-miR-4763-5p	PAR-CLIP	22012620
MIRT525494	hsa-miR-6894-3p	PAR-CLIP	22012620
MIRT2499857	hsa-miR-1185	CLIP-seq
MIRT2499858	hsa-miR-1245b-3p	CLIP-seq
MIRT2499859	hsa-miR-1468	CLIP-seq
MIRT2499860	hsa-miR-3150b-3p	CLIP-seq
MIRT2499861	hsa-miR-361-3p	CLIP-seq
MIRT2499862	hsa-miR-3679-5p	CLIP-seq
MIRT2499863	hsa-miR-3929	CLIP-seq
MIRT2499864	hsa-miR-4254	CLIP-seq
MIRT2499865	hsa-miR-4419b	CLIP-seq
MIRT2499866	hsa-miR-4436b-5p	CLIP-seq
MIRT2499867	hsa-miR-4478	CLIP-seq
MIRT2499868	hsa-miR-4689	CLIP-seq
MIRT2499869	hsa-miR-4695-5p	CLIP-seq
MIRT2499870	hsa-miR-4753-3p	CLIP-seq
MIRT2499871	hsa-miR-4766-5p	CLIP-seq
MIRT2499872	hsa-miR-4784	CLIP-seq
MIRT2499873	hsa-miR-4786-5p	CLIP-seq
MIRT2499874	hsa-miR-485-5p	CLIP-seq
MIRT2499875	hsa-miR-490-3p	CLIP-seq
MIRT2499876	hsa-miR-548ac	CLIP-seq
MIRT2499877	hsa-miR-548d-3p	CLIP-seq
MIRT2499878	hsa-miR-548z	CLIP-seq
MIRT2499879	hsa-miR-619	CLIP-seq
MIRT2499880	hsa-miR-765	CLIP-seq
MIRT2499857	hsa-miR-1185	CLIP-seq
MIRT2499858	hsa-miR-1245b-3p	CLIP-seq
MIRT2499859	hsa-miR-1468	CLIP-seq
MIRT2499860	hsa-miR-3150b-3p	CLIP-seq
MIRT2499861	hsa-miR-361-3p	CLIP-seq
MIRT2499862	hsa-miR-3679-5p	CLIP-seq
MIRT2499863	hsa-miR-3929	CLIP-seq
MIRT2499864	hsa-miR-4254	CLIP-seq
MIRT2499865	hsa-miR-4419b	CLIP-seq
MIRT2499866	hsa-miR-4436b-5p	CLIP-seq
MIRT2499867	hsa-miR-4478	CLIP-seq
MIRT2499868	hsa-miR-4689	CLIP-seq
MIRT2499869	hsa-miR-4695-5p	CLIP-seq
MIRT2499870	hsa-miR-4753-3p	CLIP-seq
MIRT2499871	hsa-miR-4766-5p	CLIP-seq
MIRT2499872	hsa-miR-4784	CLIP-seq
MIRT2499873	hsa-miR-4786-5p	CLIP-seq
MIRT2499874	hsa-miR-485-5p	CLIP-seq
MIRT2499875	hsa-miR-490-3p	CLIP-seq
MIRT2499876	hsa-miR-548ac	CLIP-seq
MIRT2499877	hsa-miR-548d-3p	CLIP-seq
MIRT2499878	hsa-miR-548z	CLIP-seq
MIRT2499879	hsa-miR-619	CLIP-seq
MIRT2499880	hsa-miR-765	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002092	Process	Positive regulation of receptor internalization	IMP	23632027
GO:0005515	Function	Protein binding	IPI	16917503, 20374249, 25312088, 28030805, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IDA	25645918
GO:0005654	Component	Nucleoplasm	IDA
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005765	Component	Lysosomal membrane	IDA	22431521, 23632027
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005765	Component	Lysosomal membrane	TAS	1993697
GO:0005768	Component	Endosome	IEA
GO:0005770	Component	Late endosome	IEA
GO:0005771	Component	Multivesicular body	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	16917503, 23632027
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	1993697, 8661157, 9602068
GO:0007160	Process	Cell-matrix adhesion	IMP	23632027
GO:0009986	Component	Cell surface	IDA	15647390
GO:0009986	Component	Cell surface	IEA
GO:0010008	Component	Endosome membrane	IDA	15229288, 22660413
GO:0010633	Process	Negative regulation of epithelial cell migration	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IMP	23632027
GO:0030154	Process	Cell differentiation	IEA
GO:0030855	Process	Epithelial cell differentiation	IEA
GO:0031088	Component	Platelet dense granule membrane	TAS
GO:0031902	Component	Late endosome membrane	IDA	23632027
GO:0031902	Component	Late endosome membrane	IEA
GO:0031904	Component	Endosome lumen	IDA	22660413
GO:0031982	Component	Vesicle	IEA
GO:0032585	Component	Multivesicular body membrane	HDA	12519789
GO:0032585	Component	Multivesicular body membrane	IDA	26280656
GO:0032991	Component	Protein-containing complex	IEA
GO:0035577	Component	Azurophil granule membrane	TAS
GO:0035646	Process	Endosome to melanosome transport	IMP	21962903
GO:0042470	Component	Melanosome	IEA
GO:0043473	Process	Pigmentation	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045785	Process	Positive regulation of cell adhesion	IEA
GO:0045807	Process	Positive regulation of endocytosis	IEA
GO:0048757	Process	Pigment granule maturation	IMP	21962903
GO:0050931	Process	Pigment cell differentiation	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070062	Component	Extracellular exosome	IDA	15908444, 21505438, 23092844, 26387950, 30871575
GO:0070062	Component	Extracellular exosome	IEA
GO:0097487	Component	Multivesicular body, internal vesicle	IDA	21962903, 26280656, 26387950
GO:1900746	Process	Regulation of vascular endothelial growth factor signaling pathway	IBA
GO:1900746	Process	Regulation of vascular endothelial growth factor signaling pathway	IEA
GO:1900746	Process	Regulation of vascular endothelial growth factor signaling pathway	IMP	23632027
GO:1901379	Process	Regulation of potassium ion transmembrane transport	IDA	15647390
GO:2001046	Process	Positive regulation of integrin-mediated signaling pathway	IMP	16917503, 23632027

Other IDs

• MIM: 155740
• HGNC: 1692
• e!Ensembl: ENSG00000135404

Protein

• UniProt ID: P08962
• Protein name: CD63 antigen (Granulophysin) (Lysosomal-associated membrane protein 3) (LAMP-3) (Lysosome integral membrane protein 1) (Limp1) (Melanoma-associated antigen ME491) (OMA81H) (Ocular melanoma-associated antigen) (Tetraspanin-30) (Tspan-30) (CD antigen CD63)
• Protein function: Functions as a cell surface receptor for TIMP1 and plays a role in the activation of cellular signaling cascades. Plays a role in the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2 and MAP kinases. Promote
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00335	Tetraspanin	10 → 230	Tetraspanin family	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected in platelets (at protein level). Dysplastic nevi, radial growth phase primary melanomas, hematopoietic cells, tissue macrophages. {ECO:0000269|PubMed:19640571}.
• Sequence:

  MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAV
  GVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFR
  QQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGIN
  FNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM

• Sequence length: 238

Pathways

KEGG:

Virion - Hepatitis viruses
Lysosome
Proteoglycans in cancer

Reactome:

Platelet degranulation
Neutrophil degranulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NIGHT BLINDNESS, CONGENITAL STATIONARY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINITIS PUNCTATA ALBESCENS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	LHGDN	17350713		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	9761121		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	27974566		★☆☆☆☆ Found in Text Mining only
Allergic sensitization	Allergic Sensitization	BEFREE	27518369, 29702283		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	21245745		★☆☆☆☆ Found in Text Mining only
Angina Pectoris	Angina pectoris	Pubtator	16856976	Stimulate	★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	35942210	Stimulate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29570265		★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	11703349	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	36826611, 7621589	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	23790102		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	33407109	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	36685514, 40534099	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	20693981, 29523123		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	20693981, 29523123	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	17498581	Associate	★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	32860660	Associate	★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	30680751		★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	28296243	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22998595, 24884960, 29069893, 31537868		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24884960, 28076321, 29069893, 34685701, 35579189, 36080806, 38403110	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	9737661	Associate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	25711438	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21521534, 31820861	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	21521534, 9736046		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25033048	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	20118909	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34122615	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	34065085	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	17390088		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	17390088		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	28642299		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	33942972	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	31402975, 31676071		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	12480921	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22895844, 29674035		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22895844, 32589377	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34638669	Stimulate	★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of adrenal gland	Congenital adrenal hypoplasia	BEFREE	23681173		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	1339263		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	25769931	Stimulate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	35710773	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	33674191	Associate	★☆☆☆☆ Found in Text Mining only
Dermatographic urticaria	Dermatographic urticaria	BEFREE	27518369		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	35710773	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	37576973	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	9165226		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	31957842	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	29967128		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	28851452, 31278881		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	30352458	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	30352458, 35124383	Associate	★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Epidermodysplasia verruciformis	Pubtator	32101370, 33218198, 35012489	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	28599425		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	28599425		★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	30680751		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	39490745	Inhibit	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	21977985	Associate	★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	15916690		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	20693981, 29523123		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	20693981	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	29523123	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29523123, 29899827		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37928523	Associate	★☆☆☆☆ Found in Text Mining only
Gray Platelet Syndrome	Gray Platelet Syndrome	BEFREE	25806575		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	26979459	Associate	★☆☆☆☆ Found in Text Mining only
Hermanski-Pudlak Syndrome	Hermansky-Pudlak Syndrome	BEFREE	26806224, 30630984, 9617741		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	27974566		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	31346174		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	22998595	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	31407387	Inhibit	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	30186468		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	8655691	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	35046480	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	35121522	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30716336		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	28642299		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	25033048	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	34684727	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	11703349	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	27665947		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24884960, 30222750, 31820861	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	20150644		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22998595, 24884960, 29069893, 31537868		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	28599425		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	9761121		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15375577, 29248729, 30680751		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30222750		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	30764484		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	15375577		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15375577, 21569129, 24884960, 27974566, 28599425, 28925394, 29844819, 30021922, 30222750, 31469961, 31588683		★☆☆☆☆ Found in Text Mining only
Malignant Testicular Germ Cell Tumor	Malignant testicular germ cell tumor	BEFREE	30764484		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	31402975, 31676071		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12579280		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	Pubtator	9822308	Stimulate	★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	25171703, 9822308	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	12740908, 1339263, 14508073, 15202015, 15375577, 23522389, 24940653, 3365686, 8151127, 8661157, 9578433		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	16116595, 19383316, 2070066, 21326294, 21977985, 23522389	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	24098347		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	24098347	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	28856701		★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidoses	Mucopolysaccharidosis	Pubtator	37787787	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	39273229	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	33819512	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	27974566, 29950415		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12960315, 15375577, 21521534, 24940653, 25354204, 28076321, 28507029, 28599425, 29523123, 30222750, 30968254		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30021215		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31020844, 9552043		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	35638410	Associate	★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	20693981		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	21149578, 28054649		★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	31022607		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	17624082		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	21903858		★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	20693981		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	19608683, 24277659, 31824842		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	19608683	Associate	★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	31022607		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	19608683		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15375577, 29248729, 30680751		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27903962, 31674708	Associate	★☆☆☆☆ Found in Text Mining only
Pruritus	Pruritus	Pubtator	19608683	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	37603355	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	17279322		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	28784104		★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	16116595	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	29468680		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	27599779, 30968254		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	29844819		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30222750		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	21521534, 30222750	Associate	★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	30764484	Stimulate	★☆☆☆☆ Found in Text Mining only
Thrombasthenia	Thrombasthenia	BEFREE	28078347		★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	19608683, 24277659		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	27179277	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	15375577		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	15375577		★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	Pubtator	38158702	Associate	★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	LHGDN	16918509		★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	BEFREE	27518369		★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	32920367	Associate	★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	20693981		★☆☆☆☆ Found in Text Mining only
X-linked Adrenal Hypoplasia	Adrenal Hypoplasia, X-Linked	BEFREE	23681173		★☆☆☆☆ Found in Text Mining only