Gene Gene information from NCBI Gene database.
Entrez ID 9668
Gene name Zinc finger protein 432
Gene symbol ZNF432
Synonyms (NCBI Gene)
-
Chromosome 19
Chromosome location 19q13.41
miRNA miRNA information provided by mirtarbase database.
59
miRTarBase ID miRNA Experiments Reference
MIRT044843 hsa-miR-320a CLASH 23622248
MIRT043010 hsa-miR-324-3p CLASH 23622248
MIRT035850 hsa-miR-1260a CLASH 23622248
MIRT706582 hsa-miR-1245a HITS-CLIP 21572407
MIRT706580 hsa-miR-8079 HITS-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IEA
GO:0003684 Function Damaged DNA binding IDA 37823600
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IDA 37823600
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
620554 20810 ENSG00000256087
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O94892
Protein name Zinc finger protein 432
Protein function Homologous recombination repressor that functions as a poly(ADP-ribose) (PAR) reader regulating DNA damage response and PARP inhibition. Once recruited to DNA lesions via DNA-, in a PAR-dependent mechanism, stimulates PARP1 activity (PubMed:3782
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01352 KRAB 7 48 KRAB box Family
PF00096 zf-C2H2 205 227 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 233 255 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 261 283 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 289 311 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 317 339 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 345 367 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 373 395 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 401 423 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 429 451 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 457 479 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 485 507 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 513 535 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 541 563 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 597 619 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 625 647 Zinc finger, C2H2 type Domain
Sequence
MINAQELLTLEDVTVEFTWEEWQLLGPFQKDLYRDVMLEIYSNLLSMGYQVSKPDALSKL
ERGEEPWTMEDERHSRICPENNEVDDHLQDHLENQRMLKSVEQYHEHNAFGNTASQTKSL
CLFRENHDTFELYIKTLKSNLSLVNQNKSCEINNSTKFSGDGKSFLHGNYEELYSAAKFS
VSTKANSTKSQVSKHQRTHEIEKNHVCSECGKAFVKKSQLTDHERVHTGEKPYGCTLCAK
VFSRKSRLNEHQRIH
KREKSFICSECGKVFTMKSRLIEHQRTHTGEKPYICNECGKGFPG
KRNLIVHQRNH
TGEKSYICSECGKGFTGKSMLIIHQRTHTGEKPYICSECGKGFTTKHYV
IIHQRNH
TGEKPYICNECGKGFTMKSRMIEHQRTHTGEKPYICSECGKGFPRKSNLIVHQ
RNH
TVEKSYLCSECGKGFTVKSMLIIHQRTHTGEKPYTCSECGKGFPLKSRLIVHQRTHT
GEKPYRCSECGKGFIVNSGLMLHQRTHTGEKPYICNECGKGFAFKSNLVVHQRTHTGEKP
FMCSECGKGFTMKRYLIVHQQIHTEEKSCICSECGRGFAKETELALHKQVHTGEKPYGCN
ECGKGFTMKSRLIVHQRTH
TGEKPFVCSECRKAFSSKRNLIVHQRTHNGNKP
Sequence length 652
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Generic Transcription Pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
BREAST NEOPLASMS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Asthma Asthma BEFREE 24280104
★☆☆☆☆
Found in Text Mining only
Asthma Asthma GWASCAT_DG 24280104
★☆☆☆☆
Found in Text Mining only
Asthma Asthma Pubtator 24280104 Associate
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma CTD_human_DG 18507500
★☆☆☆☆
Found in Text Mining only
Childhood asthma Asthma BEFREE 24280104
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer CTD_human_DG 18507500
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal Neoplasms CTD_human_DG 18507500
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast Breast Cancer CTD_human_DG 18507500
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of breast Breast Cancer UNIPROT_DG
★☆☆☆☆
Found in Text Mining only
Mammary Carcinoma, Human Marfan Syndrome CTD_human_DG 18507500
★☆☆☆☆
Found in Text Mining only