Gene Gene information from NCBI Gene database.
Entrez ID 9657
Gene name IQ motif containing B1
Gene symbol IQCB1
Synonyms (NCBI Gene)
NPHP5PIQSLSN5
Chromosome 3
Chromosome location 3q13.33|3q21.1
Summary This gene encodes a nephrocystin protein that interacts with calmodulin and the retinitis pigmentosa GTPase regulator protein. The encoded protein has a central coiled-coil region and two calmodulin-binding IQ domains. It is localized to the primary cilia
SNPs SNP information provided by dbSNP.
28
SNP ID Visualize variation Clinical significance Consequence
rs1141528 A>T Benign, pathogenic, likely-benign Non coding transcript variant, intron variant, coding sequence variant, missense variant
rs121918244 G>A Pathogenic Non coding transcript variant, stop gained, coding sequence variant
rs121918245 G>A,C Pathogenic Non coding transcript variant, stop gained, missense variant, coding sequence variant
rs140630401 C>T Conflicting-interpretations-of-pathogenicity, likely-pathogenic Missense variant, intron variant, non coding transcript variant, coding sequence variant
rs201405662 G>A,C Pathogenic, likely-pathogenic Missense variant, 5 prime UTR variant, coding sequence variant, non coding transcript variant, stop gained, intron variant
miRNA miRNA information provided by mirtarbase database.
83
miRTarBase ID miRNA Experiments Reference
MIRT027674 hsa-miR-98-5p Microarray 19088304
MIRT030516 hsa-miR-24-3p Microarray 19748357
MIRT047676 hsa-miR-10a-5p CLASH 23622248
MIRT727435 hsa-miR-30a-5p HITS-CLIP 22473208
MIRT727434 hsa-miR-30b-5p HITS-CLIP 22473208
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
27
GO ID Ontology Definition Evidence Reference
GO:0001750 Component Photoreceptor outer segment IEA
GO:0005515 Function Protein binding IPI 18723859, 21565611, 23446637, 25552655, 26638075, 28514442, 29959317, 32296183, 33961781
GO:0005516 Function Calmodulin binding IDA 15723066
GO:0005516 Function Calmodulin binding IEA
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609237 28949 ENSG00000173226
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q15051
Protein name IQ calmodulin-binding motif-containing protein 1 (Nephrocystin-5) (p53 and DNA damage-regulated IQ motif protein) (PIQ)
Protein function Involved in ciliogenesis. The function in an early step in cilia formation depends on its association with CEP290/NPHP6 (PubMed:21565611, PubMed:23446637). Involved in regulation of the BBSome complex integrity, specifically for presence of BBS2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00612 IQ 295 315 IQ calmodulin-binding motif Motif
PF00612 IQ 388 408 IQ calmodulin-binding motif Motif
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed in fetal and adult tissues. Localized to the outer segments and connecting cilia of photoreceptor cells. Up-regulated in a number of primary colorectal and gastric tumors. {ECO:0000269|PubMed:15723066, ECO:000026
Sequence
MKPTGTDPRILSIAAEVAKSPEQNVPVILLKLKEIINITPLGSSELKKIKQDIYCYDLIQ
YCLLVLSQDYSRIQGGWTTISQLTQILSHCCVGLEPGEDAEEFYNELLPSAAENFLVLGR
QLQTCFINAAKAEEKDELLHFFQIVTDSLFWLLGGHVELIQNVLQSDHFLHLLQADNVQI
GSAVMMMLQNILQINSGDLLRIGRKALYSILDEVIFKLFSTPSPVIRSTATKLLLLMAES
HQEILILLRQSTCYKGLRRLLSKQETGTEFSQELRQLVGLLSPMVYQEVEEQKLHQAACL
IQAYWKGFQTRKRLK
KLPSAVIALQRSFRSKRSKMLLEINRQKEEEDLKLQLQLQRQRAM
RLSRELQLSMLEIVHPGQVEKHYREMEEKSALIIQKHWRGYRERKNFHQQRQSLIEYKAA
VTLQRAALKFLAKCRKKKKLFAPWRGLQELTDARRVELKKRVDDYVRRHLGSPMSDVVSR
ELHAQAQERLQHYFMGRALEERAQQHREALIAQISTNVEQLMKAPSLKEAEGKEPELFLS
RSRPVAAKAKQAHLTTLKHIQAPWWKKLGEESGDEIDVPKDELSIELENLFIGGTKPP
Sequence length 598
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Anchoring of the basal body to the plasma membrane
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
31
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
IQCB1-related disorder Likely pathogenic; Pathogenic rs1949313357, rs121918244, rs1474058708, rs398123538 RCV003407857
RCV003398416
RCV004755699
RCV004755762
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Leber congenital amaurosis Pathogenic; Likely pathogenic rs1948821736, rs867772426, rs750962965, rs201405662, rs373909351, rs387907009, rs1553722736, rs748559081 RCV001591797
RCV005419287
RCV000505085
RCV000504702
RCV006261943
View all (3 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Melanoma Likely pathogenic rs768014052 RCV005930675
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Nephronophthisis Pathogenic; Likely pathogenic rs2108591614, rs1201853761, rs1226321871, rs776023179, rs773848660, rs1250919247, rs2108643223, rs2108571563, rs1372024420, rs1949313357, rs867772426, rs587783011, rs121918244, rs750962965, rs1474058708
View all (25 more)
RCV001387062
RCV002541151
RCV001984251
RCV002037700
RCV001961933
View all (36 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Bardet-Biedl syndrome Conflicting classifications of pathogenicity ClinVar
Disgenet
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)
Cervical cancer Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Amaurosis congenita of Leber, type 1 Leber congenital amaurosis BEFREE 20881296, 21220633, 21245082, 21901789, 24066033, 27506978, 29219953, 29322253, 30713422, 31212307
★☆☆☆☆
Found in Text Mining only
Amaurosis hypertrichosis Amaurosis hypertrichosis Pubtator 29322253 Associate
★☆☆☆☆
Found in Text Mining only
Autism Spectrum Disorders Autism Spectrum Disorder BEFREE 29503543
★☆☆☆☆
Found in Text Mining only
Bardet-Biedl Syndrome Bardet-Biedl Syndrome BEFREE 25552655
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)
Blindness Blindness Pubtator 36084637 Associate
★☆☆☆☆
Found in Text Mining only
Cataract Cataract HPO_DG
★☆☆☆☆
Found in Text Mining only
Cerebrovascular accident Stroke BEFREE 31520846
★☆☆☆☆
Found in Text Mining only
Chronic kidney disease stage 5 Kidney Disease HPO_DG
★☆☆☆☆
Found in Text Mining only
Chronic kidney disease stage 5 Kidney Disease CLINVAR_DG
★☆☆☆☆
Found in Text Mining only
Ciliopathies Ciliopathy Pubtator 20007846, 21068128, 27491411, 36084637 Associate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations