Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9628
Gene name	Regulator of G protein signaling 6
Gene symbol	RGS6
Synonyms (NCBI Gene)	GAPHA117S914
Chromosome	14
Chromosome location	14q24.2
Summary	This gene encodes a member of the RGS (regulator of G protein signaling) family of proteins, which are defined by the presence of a RGS domain that confers the GTPase-activating activity of these proteins toward certain G alpha subunits. This protein also

277

Show/Hide all (277)

miRTarBase ID	miRNA	Experiments	Reference
MIRT715447	hsa-miR-3681-3p	HITS-CLIP	19536157
MIRT715446	hsa-miR-216a-3p	HITS-CLIP	19536157
MIRT715445	hsa-miR-128-3p	HITS-CLIP	19536157
MIRT715444	hsa-miR-27b-3p	HITS-CLIP	19536157
MIRT715443	hsa-miR-27a-3p	HITS-CLIP	19536157
MIRT715442	hsa-miR-4639-3p	HITS-CLIP	19536157
MIRT715441	hsa-miR-205-5p	HITS-CLIP	19536157
MIRT715440	hsa-miR-130b-5p	HITS-CLIP	19536157
MIRT715439	hsa-miR-4290	HITS-CLIP	19536157
MIRT715438	hsa-miR-513a-5p	HITS-CLIP	19536157
MIRT715437	hsa-miR-6794-3p	HITS-CLIP	19536157
MIRT715436	hsa-miR-4279	HITS-CLIP	19536157
MIRT715435	hsa-miR-3157-3p	HITS-CLIP	19536157
MIRT715434	hsa-miR-874-3p	HITS-CLIP	19536157
MIRT715433	hsa-miR-629-3p	HITS-CLIP	19536157
MIRT642676	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT642675	hsa-miR-129-1-3p	HITS-CLIP	23824327
MIRT642674	hsa-miR-129-2-3p	HITS-CLIP	23824327
MIRT642673	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT642672	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT642671	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT642670	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT642669	hsa-miR-204-3p	HITS-CLIP	23824327
MIRT642668	hsa-miR-4646-5p	HITS-CLIP	23824327
MIRT642667	hsa-miR-3192-5p	HITS-CLIP	23824327
MIRT642666	hsa-miR-619-5p	HITS-CLIP	23824327
MIRT642665	hsa-miR-6506-5p	HITS-CLIP	23824327
MIRT642664	hsa-miR-3182	HITS-CLIP	23824327
MIRT642663	hsa-miR-1233-3p	HITS-CLIP	23824327
MIRT642662	hsa-miR-938	HITS-CLIP	23824327
MIRT642661	hsa-miR-4747-5p	HITS-CLIP	23824327
MIRT642660	hsa-miR-5196-5p	HITS-CLIP	23824327
MIRT642659	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT642658	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT642657	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT642656	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT495514	hsa-miR-4747-3p	PAR-CLIP	22291592
MIRT495513	hsa-miR-6760-5p	PAR-CLIP	22291592
MIRT495512	hsa-miR-1321	PAR-CLIP	22291592
MIRT495511	hsa-miR-4739	PAR-CLIP	22291592
MIRT495510	hsa-miR-4756-5p	PAR-CLIP	22291592
MIRT495509	hsa-miR-135a-3p	PAR-CLIP	22291592
MIRT495508	hsa-miR-765	PAR-CLIP	22291592
MIRT495507	hsa-miR-1289	PAR-CLIP	22291592
MIRT495506	hsa-miR-7106-5p	PAR-CLIP	22291592
MIRT495505	hsa-miR-3162-5p	PAR-CLIP	22291592
MIRT495504	hsa-miR-5571-3p	PAR-CLIP	22291592
MIRT443861	hsa-miR-6895-5p	PAR-CLIP	22100165
MIRT443860	hsa-miR-6838-3p	PAR-CLIP	22100165
MIRT443859	hsa-miR-3691-3p	PAR-CLIP	22100165
MIRT443858	hsa-miR-5090	PAR-CLIP	22100165
MIRT443856	hsa-miR-6775-5p	PAR-CLIP	22100165
MIRT443857	hsa-miR-4508	PAR-CLIP	22100165
MIRT443855	hsa-miR-4667-5p	PAR-CLIP	22100165
MIRT443854	hsa-miR-4700-5p	PAR-CLIP	22100165
MIRT443853	hsa-miR-8089	PAR-CLIP	22100165
MIRT443852	hsa-miR-4480	PAR-CLIP	22100165
MIRT443851	hsa-miR-4731-5p	PAR-CLIP	22100165
MIRT443850	hsa-miR-4505	PAR-CLIP	22100165
MIRT443849	hsa-miR-5787	PAR-CLIP	22100165
MIRT443848	hsa-miR-6731-5p	PAR-CLIP	22100165
MIRT443847	hsa-miR-8085	PAR-CLIP	22100165
MIRT443846	hsa-miR-4492	PAR-CLIP	22100165
MIRT443844	hsa-miR-4498	PAR-CLIP	22100165
MIRT443845	hsa-miR-5001-5p	PAR-CLIP	22100165
MIRT443843	hsa-miR-762	PAR-CLIP	22100165
MIRT443842	hsa-miR-3175	PAR-CLIP	22100165
MIRT443841	hsa-miR-1343-5p	PAR-CLIP	22100165
MIRT443840	hsa-miR-939-5p	PAR-CLIP	22100165
MIRT443839	hsa-miR-6825-5p	PAR-CLIP	22100165
MIRT443838	hsa-miR-185-3p	PAR-CLIP	22100165
MIRT443837	hsa-miR-6727-5p	PAR-CLIP	22100165
MIRT443836	hsa-miR-3150a-3p	PAR-CLIP	22100165
MIRT443835	hsa-miR-6763-5p	PAR-CLIP	22100165
MIRT715447	hsa-miR-3681-3p	HITS-CLIP	19536157
MIRT715446	hsa-miR-216a-3p	HITS-CLIP	19536157
MIRT715445	hsa-miR-128-3p	HITS-CLIP	19536157
MIRT715444	hsa-miR-27b-3p	HITS-CLIP	19536157
MIRT715443	hsa-miR-27a-3p	HITS-CLIP	19536157
MIRT715442	hsa-miR-4639-3p	HITS-CLIP	19536157
MIRT715441	hsa-miR-205-5p	HITS-CLIP	19536157
MIRT715440	hsa-miR-130b-5p	HITS-CLIP	19536157
MIRT715439	hsa-miR-4290	HITS-CLIP	19536157
MIRT715438	hsa-miR-513a-5p	HITS-CLIP	19536157
MIRT715437	hsa-miR-6794-3p	HITS-CLIP	19536157
MIRT715436	hsa-miR-4279	HITS-CLIP	19536157
MIRT715435	hsa-miR-3157-3p	HITS-CLIP	19536157
MIRT715434	hsa-miR-874-3p	HITS-CLIP	19536157
MIRT715433	hsa-miR-629-3p	HITS-CLIP	19536157
MIRT642676	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT642675	hsa-miR-129-1-3p	HITS-CLIP	23824327
MIRT642674	hsa-miR-129-2-3p	HITS-CLIP	23824327
MIRT642673	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT642672	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT642671	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT642670	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT642669	hsa-miR-204-3p	HITS-CLIP	23824327
MIRT642668	hsa-miR-4646-5p	HITS-CLIP	23824327
MIRT642667	hsa-miR-3192-5p	HITS-CLIP	23824327
MIRT642666	hsa-miR-619-5p	HITS-CLIP	23824327
MIRT642665	hsa-miR-6506-5p	HITS-CLIP	23824327
MIRT642664	hsa-miR-3182	HITS-CLIP	23824327
MIRT642663	hsa-miR-1233-3p	HITS-CLIP	23824327
MIRT642662	hsa-miR-938	HITS-CLIP	23824327
MIRT642661	hsa-miR-4747-5p	HITS-CLIP	23824327
MIRT642660	hsa-miR-5196-5p	HITS-CLIP	23824327
MIRT642659	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT642658	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT642657	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT642656	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT495514	hsa-miR-4747-3p	PAR-CLIP	22291592
MIRT495513	hsa-miR-6760-5p	PAR-CLIP	22291592
MIRT495512	hsa-miR-1321	PAR-CLIP	22291592
MIRT495511	hsa-miR-4739	PAR-CLIP	22291592
MIRT495510	hsa-miR-4756-5p	PAR-CLIP	22291592
MIRT495509	hsa-miR-135a-3p	PAR-CLIP	22291592
MIRT495508	hsa-miR-765	PAR-CLIP	22291592
MIRT495507	hsa-miR-1289	PAR-CLIP	22291592
MIRT495506	hsa-miR-7106-5p	PAR-CLIP	22291592
MIRT495505	hsa-miR-3162-5p	PAR-CLIP	22291592
MIRT495504	hsa-miR-5571-3p	PAR-CLIP	22291592
MIRT443861	hsa-miR-6895-5p	PAR-CLIP	22100165
MIRT443860	hsa-miR-6838-3p	PAR-CLIP	22100165
MIRT443859	hsa-miR-3691-3p	PAR-CLIP	22100165
MIRT443858	hsa-miR-5090	PAR-CLIP	22100165
MIRT443856	hsa-miR-6775-5p	PAR-CLIP	22100165
MIRT443857	hsa-miR-4508	PAR-CLIP	22100165
MIRT443855	hsa-miR-4667-5p	PAR-CLIP	22100165
MIRT443854	hsa-miR-4700-5p	PAR-CLIP	22100165
MIRT443853	hsa-miR-8089	PAR-CLIP	22100165
MIRT443852	hsa-miR-4480	PAR-CLIP	22100165
MIRT443851	hsa-miR-4731-5p	PAR-CLIP	22100165
MIRT443850	hsa-miR-4505	PAR-CLIP	22100165
MIRT443849	hsa-miR-5787	PAR-CLIP	22100165
MIRT443848	hsa-miR-6731-5p	PAR-CLIP	22100165
MIRT443847	hsa-miR-8085	PAR-CLIP	22100165
MIRT443846	hsa-miR-4492	PAR-CLIP	22100165
MIRT443844	hsa-miR-4498	PAR-CLIP	22100165
MIRT443845	hsa-miR-5001-5p	PAR-CLIP	22100165
MIRT443843	hsa-miR-762	PAR-CLIP	22100165
MIRT443842	hsa-miR-3175	PAR-CLIP	22100165
MIRT443841	hsa-miR-1343-5p	PAR-CLIP	22100165
MIRT443840	hsa-miR-939-5p	PAR-CLIP	22100165
MIRT443839	hsa-miR-6825-5p	PAR-CLIP	22100165
MIRT443838	hsa-miR-185-3p	PAR-CLIP	22100165
MIRT443837	hsa-miR-6727-5p	PAR-CLIP	22100165
MIRT443836	hsa-miR-3150a-3p	PAR-CLIP	22100165
MIRT443835	hsa-miR-6763-5p	PAR-CLIP	22100165
MIRT1304485	hsa-miR-4701-5p	CLIP-seq
MIRT1304486	hsa-miR-588	CLIP-seq
MIRT1304487	hsa-miR-1972	CLIP-seq
MIRT1304488	hsa-miR-4687-3p	CLIP-seq
MIRT1304489	hsa-miR-647	CLIP-seq
MIRT1304490	hsa-let-7a	CLIP-seq
MIRT1304491	hsa-let-7b	CLIP-seq
MIRT1304492	hsa-let-7c	CLIP-seq
MIRT1304493	hsa-let-7d	CLIP-seq
MIRT1304494	hsa-let-7e	CLIP-seq
MIRT1304495	hsa-let-7f	CLIP-seq
MIRT1304496	hsa-let-7g	CLIP-seq
MIRT1304497	hsa-let-7i	CLIP-seq
MIRT1304498	hsa-miR-1224-3p	CLIP-seq
MIRT1304499	hsa-miR-1260	CLIP-seq
MIRT1304500	hsa-miR-1260b	CLIP-seq
MIRT1304501	hsa-miR-1280	CLIP-seq
MIRT1304502	hsa-miR-1294	CLIP-seq
MIRT1304503	hsa-miR-137	CLIP-seq
MIRT1304504	hsa-miR-1915	CLIP-seq
MIRT1304505	hsa-miR-196a	CLIP-seq
MIRT1304506	hsa-miR-196b	CLIP-seq
MIRT1304507	hsa-miR-202	CLIP-seq
MIRT1304508	hsa-miR-203	CLIP-seq
MIRT1304509	hsa-miR-3194-3p	CLIP-seq
MIRT1304510	hsa-miR-34a	CLIP-seq
MIRT1304511	hsa-miR-34c-5p	CLIP-seq
MIRT1304512	hsa-miR-3650	CLIP-seq
MIRT1304513	hsa-miR-3663-3p	CLIP-seq
MIRT1304514	hsa-miR-3665	CLIP-seq
MIRT1304515	hsa-miR-3934	CLIP-seq
MIRT1304516	hsa-miR-3944-5p	CLIP-seq
MIRT1304517	hsa-miR-4267	CLIP-seq
MIRT1304518	hsa-miR-4283	CLIP-seq
MIRT1304519	hsa-miR-4458	CLIP-seq
MIRT1304520	hsa-miR-4459	CLIP-seq
MIRT1304521	hsa-miR-4468	CLIP-seq
MIRT1304522	hsa-miR-4489	CLIP-seq
MIRT1304523	hsa-miR-449a	CLIP-seq
MIRT1304524	hsa-miR-449b	CLIP-seq
MIRT1304525	hsa-miR-4500	CLIP-seq
MIRT1304526	hsa-miR-4663	CLIP-seq
MIRT1304527	hsa-miR-4693-3p	CLIP-seq
MIRT1304528	hsa-miR-4695-5p	CLIP-seq
MIRT1304485	hsa-miR-4701-5p	CLIP-seq
MIRT1304529	hsa-miR-4710	CLIP-seq
MIRT1304530	hsa-miR-4726-3p	CLIP-seq
MIRT1304531	hsa-miR-4773	CLIP-seq
MIRT1304532	hsa-miR-4779	CLIP-seq
MIRT1304533	hsa-miR-4795-3p	CLIP-seq
MIRT1304534	hsa-miR-496	CLIP-seq
MIRT1304535	hsa-miR-532-3p	CLIP-seq
MIRT1304536	hsa-miR-586	CLIP-seq
MIRT1304486	hsa-miR-588	CLIP-seq
MIRT1304537	hsa-miR-605	CLIP-seq
MIRT1304538	hsa-miR-657	CLIP-seq
MIRT1304539	hsa-miR-665	CLIP-seq
MIRT1304540	hsa-miR-939	CLIP-seq
MIRT1304541	hsa-miR-98	CLIP-seq
MIRT2090209	hsa-miR-1184	CLIP-seq
MIRT2090210	hsa-miR-1205	CLIP-seq
MIRT2090211	hsa-miR-1254	CLIP-seq
MIRT2090212	hsa-miR-205	CLIP-seq
MIRT2090213	hsa-miR-3116	CLIP-seq
MIRT2090214	hsa-miR-3144-5p	CLIP-seq
MIRT2090215	hsa-miR-3158-5p	CLIP-seq
MIRT2090216	hsa-miR-3191	CLIP-seq
MIRT2090217	hsa-miR-320a	CLIP-seq
MIRT2090218	hsa-miR-320b	CLIP-seq
MIRT2090219	hsa-miR-320c	CLIP-seq
MIRT2090220	hsa-miR-320d	CLIP-seq
MIRT2090221	hsa-miR-3918	CLIP-seq
MIRT2090222	hsa-miR-4428	CLIP-seq
MIRT2090223	hsa-miR-4429	CLIP-seq
MIRT2090224	hsa-miR-4434	CLIP-seq
MIRT2090225	hsa-miR-4516	CLIP-seq
MIRT2090226	hsa-miR-4652-5p	CLIP-seq
MIRT2090227	hsa-miR-4768-3p	CLIP-seq
MIRT2090228	hsa-miR-515-3p	CLIP-seq
MIRT2090229	hsa-miR-519e	CLIP-seq
MIRT2090230	hsa-miR-550a	CLIP-seq
MIRT1304538	hsa-miR-657	CLIP-seq
MIRT2090231	hsa-miR-661	CLIP-seq
MIRT1304539	hsa-miR-665	CLIP-seq
MIRT2314969	hsa-miR-1233	CLIP-seq
MIRT2314970	hsa-miR-129-3p	CLIP-seq
MIRT2314971	hsa-miR-1304	CLIP-seq
MIRT1304504	hsa-miR-1915	CLIP-seq
MIRT2314972	hsa-miR-2467-5p	CLIP-seq
MIRT2314973	hsa-miR-3154	CLIP-seq
MIRT2314974	hsa-miR-3166	CLIP-seq
MIRT2314975	hsa-miR-3179	CLIP-seq
MIRT2314976	hsa-miR-3188	CLIP-seq
MIRT2314977	hsa-miR-3190	CLIP-seq
MIRT2090217	hsa-miR-320a	CLIP-seq
MIRT2090218	hsa-miR-320b	CLIP-seq
MIRT2090219	hsa-miR-320c	CLIP-seq
MIRT2090220	hsa-miR-320d	CLIP-seq
MIRT2314978	hsa-miR-376c	CLIP-seq
MIRT2314979	hsa-miR-3975	CLIP-seq
MIRT2314980	hsa-miR-4311	CLIP-seq
MIRT2090223	hsa-miR-4429	CLIP-seq
MIRT2314981	hsa-miR-4448	CLIP-seq
MIRT2314982	hsa-miR-4660	CLIP-seq
MIRT1304530	hsa-miR-4726-3p	CLIP-seq
MIRT2314983	hsa-miR-4755-3p	CLIP-seq
MIRT2090227	hsa-miR-4768-3p	CLIP-seq
MIRT2314984	hsa-miR-485-5p	CLIP-seq
MIRT2314985	hsa-miR-635	CLIP-seq
MIRT1304539	hsa-miR-665	CLIP-seq
MIRT2314986	hsa-miR-671-5p	CLIP-seq
MIRT1304540	hsa-miR-939	CLIP-seq
MIRT2458152	hsa-miR-1262	CLIP-seq
MIRT2458153	hsa-miR-1293	CLIP-seq
MIRT2458154	hsa-miR-4259	CLIP-seq
MIRT2458155	hsa-miR-4483	CLIP-seq
MIRT2458156	hsa-miR-4640-5p	CLIP-seq
MIRT2458157	hsa-miR-4701-3p	CLIP-seq
MIRT2458158	hsa-miR-4726-5p	CLIP-seq
MIRT2611333	hsa-miR-1292	CLIP-seq
MIRT2611334	hsa-miR-370	CLIP-seq
MIRT2611335	hsa-miR-4471	CLIP-seq
MIRT2611336	hsa-miR-4763-5p	CLIP-seq
MIRT2090230	hsa-miR-550a	CLIP-seq
MIRT2611333	hsa-miR-1292	CLIP-seq
MIRT2611334	hsa-miR-370	CLIP-seq
MIRT2611335	hsa-miR-4471	CLIP-seq
MIRT2611336	hsa-miR-4763-5p	CLIP-seq
MIRT2090230	hsa-miR-550a	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IDA	10521509
GO:0005096	Function	GTPase activator activity	IEA
GO:0005096	Function	GTPase activator activity	TAS	10083744
GO:0005515	Function	Protein binding	IPI	22939624, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	10521509
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	IEA
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	TAS	10083744
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0016020	Component	Membrane	IDA	10521509
GO:0016020	Component	Membrane	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0043005	Component	Neuron projection	IBA
GO:0043547	Process	Positive regulation of GTPase activity	IDA	10521509

MIM	HGNC	e!Ensembl
603894	10002	ENSG00000182732

P49758

Protein name

Regulator of G-protein signaling 6 (RGS6) (S914)

Protein function

Regulates G protein-coupled receptor signaling cascades. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. The RGS6/GNB5 dimer enhances GNAO1 GTPa

PDB

2ES0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00610	DEP	43 → 113	Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)	Domain
PF18148	RGS_DHEX	116 → 217	Regulator of G-protein signalling DHEX domain	Domain
PF00631	G-gamma	255 → 319	GGL domain	Domain
PF00615	RGS	336 → 450	Regulator of G protein signaling domain	Domain

Sequence

MAQGSGDQRAVGVADPEESSPNMIVYCKIEDIITKMQDDKTGGVPIRTVKSFLSKIPSVV
TGTDIVQWLMKNLSIEDPVEAIHLGSLIAAQGYIFPISDHVLTMKDDGTFYRFQAPYFWP
SNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKI
DRKKDKTERKILDSQERAFWDVHRPVPGCVNTTEMDIRKCRRLKNPQKVKKSVYGVTEES
QAQSPVHVLSQPIRKTTKEDIRKQITFLNAQIDRHCLKMSKVAESLIAYTEQYVEYDPLI
TPAEPSNPWISDDVALWDIEMSKEPSQQRVKRWGFSFDEILKDQVGRDQFLRFLESEFSS
ENLRFWLAVQDLKKQPLQDVAKRVEEIWQEFLAPGAPSAINLDSHSYEITSQNVKDGGRY
TFEDAQEHIYKLMKSDSYARFLRSNAYQDLLLAKKKGKSLAGKRLTGLMQSS

Sequence length

472

Interactions

View interactions

	Reactome
			G alpha (i) signalling events Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (35)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANOREXIA NERVOSA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ANEURYSM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUCHENNE MUSCULAR DYSTROPHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PREECLAMPSIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOPENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMALL CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPORADIC AMYOTROPHIC LATERAL SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (85)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	17426081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	23619123		★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha-Thalassemia	alpha Thalassemia	BEFREE	26753516		★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha^+^ Thalassemia	alpha Thalassemia	BEFREE	26753516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	28701309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	11005256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	24204714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	29895617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	15375002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18191019, 20642825, 21041304, 23598467, 29421981, 8347849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20642825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35902557	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	BEFREE	29573509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	15375002, 27713144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	18191019, 31554007, 8270251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	11752813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	23338613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Child Development Disorders, Pervasive	Development Disorder	GWASCAT_DG	28540026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26653562, 31332286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34092617	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital cataract	Congenital Cataract	BEFREE	25525169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	29079565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Costello syndrome (disorder)	Costello syndrome	BEFREE	19995790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	30356372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsies, Partial	Epilepsy	BEFREE	31639411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial aplasia of the vermis	Cerebellar vermis agenesis	BEFREE	24168557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	31639411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia	Focal cortical dysplasia	BEFREE	31639411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	25120773, 26097584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	25120773, 26097584	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	23619123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoplasia of thumb	Hypoplasia Of Thumb	BEFREE	30366734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28086844, 28340864, 28502419, 28787101, 28886713, 29017478, 31166938, 31186636, 31467375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29030432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ketosis	Ketosis	BEFREE	31179571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal cleft	Laryngeal cleft	BEFREE	8290270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	19435509	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	28665981	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	28665981	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22614672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	28086844, 28502419, 29858026, 30961952, 31015884, 31578022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35902557	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	23619123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18191019, 20642825, 21041304, 23598467, 29421981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	18191019, 31554007, 8270251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	1520317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	15375002, 27713144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15375002, 21041304, 23338613, 26653562, 28240531, 30356372, 31041977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	23598467		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29620236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	25525169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	PSYGENET_DG	24421401		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	GWASCAT_DG	30014611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	8207976, 9783802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	28035008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	30961952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	18627284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12469204, 1568246, 16217026, 17426081, 18191019, 18627284, 2031288, 20629949, 22614672, 23598467, 23619123, 23723238, 26653562, 27614886, 27713144, 27896589, 8270251 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	23619123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	23619123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28163190		★★★★★ ★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	1280127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	1280127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	11005256, 12524206, 12573431, 1457041, 17426081, 18218617, 21478499, 23361976, 23487764, 29680440, 29804243, 7575561, 8499944, 9668168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	BEFREE	7621416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28543987, 8270251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	28681264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28090039, 31191459		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	28090039	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity Abdominal	Obesity	Pubtator	28090039	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	12600941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25120791	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	17426081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	GWASCAT_DG	26626624		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	BEFREE	28681264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29017478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	7621416		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcopenia	Sarcopenia	Pubtator	36573383	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizoaffective Disorder	Schizoaffective Disorder	GWASCAT_DG	26821981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	25056061, 26198764, 26821981, 28540026, 28991256, 29483656, 30285260, 31268507, 31374203		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Small cell carcinoma of lung	Lung carcinoma	BEFREE	31186636, 8270251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	BEFREE	22713807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	12469204, 19143643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35902557	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	12600941		★★★★★ ★☆☆☆☆ Found in Text Mining only

RGS6 (regulator of G protein signaling 6)