Gene Gene information from NCBI Gene database.
Entrez ID 9626
Gene name Guanylate cyclase activator 1C
Gene symbol GUCA1C
Synonyms (NCBI Gene)
GCAP3
Chromosome 3
Chromosome location 3q13.13
miRNA miRNA information provided by mirtarbase database.
17
miRTarBase ID miRNA Experiments Reference
MIRT1038382 hsa-miR-302a CLIP-seq
MIRT1038383 hsa-miR-302b CLIP-seq
MIRT1038384 hsa-miR-302c CLIP-seq
MIRT1038385 hsa-miR-302d CLIP-seq
MIRT1038386 hsa-miR-302e CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0007165 Process Signal transduction TAS 10037746
GO:0007601 Process Visual perception TAS 10037746
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605128 4680 ENSG00000138472
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O95843
Protein name Guanylyl cyclase-activating protein 3 (GCAP 3) (Guanylate cyclase activator 1C)
Protein function Stimulates guanylyl cyclase 1 (GC1) and GC2 when free calcium ions concentration is low and inhibits guanylyl cyclases when free calcium ions concentration is elevated. This Ca(2+)-sensitive regulation of guanylyl cyclase (GC) is a key event in
PDB 2GGZ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00036 EF-hand_1 92 120 EF hand Domain
Tissue specificity TISSUE SPECIFICITY: Retina.
Sequence
MGNGKSIAGDQKAVPTQETHVWYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQV
YNTFDTNKDGFVDFLEFIAAVNLIMQEKMEQKLKWYFKLYDADGNGSIDKNELLDMFMAV
QALNGQQTLSPEEFINLVFHKIDINNDGELTLEEFINGMAKDQDLLEIVYKSFDFSNVLR
VICNGKQPDMETDSSKSPDKAGLGKVKMK
Sequence length 209
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Phototransduction   Inactivation, recovery and regulation of the phototransduction cascade
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
PELVIC ORGAN PROLAPSE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Glaucoma 3 Primary Congenital A Glaucoma Pubtator 33801495 Associate
★☆☆☆☆
Found in Text Mining only
Pelvic Organ Prolapse Pelvic Organ Prolapse GWASCAT_DG 26545240
★★☆☆☆
Found in Text Mining + Unknown/Other Associations