TCL1B (TCL1 family AKT coactivator B)

Gene

• Entrez ID: 9623
• Gene name: TCL1 family AKT coactivator B
• Gene symbol: TCL1B
• Synonyms (NCBI Gene): SYN-1, TML1
• Chromosome: 14
• Chromosome location: 14q32.13

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021345	hsa-miR-9-5p	Microarray	17612493
MIRT025631	hsa-miR-7-5p	Microarray	17612493
MIRT1416621	hsa-miR-1470	CLIP-seq
MIRT1416622	hsa-miR-3184	CLIP-seq
MIRT1416623	hsa-miR-3944-5p	CLIP-seq
MIRT1416624	hsa-miR-423-5p	CLIP-seq
MIRT1416625	hsa-miR-4286	CLIP-seq
MIRT1416626	hsa-miR-4420	CLIP-seq
MIRT1416627	hsa-miR-4667-3p	CLIP-seq
MIRT1416628	hsa-miR-4699-5p	CLIP-seq
MIRT2124927	hsa-miR-1207-5p	CLIP-seq
MIRT2124928	hsa-miR-1972	CLIP-seq
MIRT2124929	hsa-miR-214	CLIP-seq
MIRT2124930	hsa-miR-3194-5p	CLIP-seq
MIRT2124931	hsa-miR-3619-5p	CLIP-seq
MIRT2124932	hsa-miR-3918	CLIP-seq
MIRT2124933	hsa-miR-3926	CLIP-seq
MIRT2124934	hsa-miR-4291	CLIP-seq
MIRT2124935	hsa-miR-4530	CLIP-seq
MIRT2124936	hsa-miR-4640-5p	CLIP-seq
MIRT2124937	hsa-miR-4726-5p	CLIP-seq
MIRT2124938	hsa-miR-4763-3p	CLIP-seq
MIRT2124939	hsa-miR-761	CLIP-seq
MIRT2124940	hsa-miR-922	CLIP-seq
MIRT2124927	hsa-miR-1207-5p	CLIP-seq
MIRT2347374	hsa-miR-1287	CLIP-seq
MIRT2347375	hsa-miR-1827	CLIP-seq
MIRT2124928	hsa-miR-1972	CLIP-seq
MIRT2124929	hsa-miR-214	CLIP-seq
MIRT2347376	hsa-miR-3135b	CLIP-seq
MIRT2347377	hsa-miR-342-5p	CLIP-seq
MIRT2347378	hsa-miR-3612	CLIP-seq
MIRT2124931	hsa-miR-3619-5p	CLIP-seq
MIRT2124932	hsa-miR-3918	CLIP-seq
MIRT2347379	hsa-miR-4443	CLIP-seq
MIRT2124935	hsa-miR-4530	CLIP-seq
MIRT2124936	hsa-miR-4640-5p	CLIP-seq
MIRT2347380	hsa-miR-4664-5p	CLIP-seq
MIRT2124937	hsa-miR-4726-5p	CLIP-seq
MIRT2347381	hsa-miR-4738-3p	CLIP-seq
MIRT2124938	hsa-miR-4763-3p	CLIP-seq
MIRT2347382	hsa-miR-4793-3p	CLIP-seq
MIRT2347383	hsa-miR-4793-5p	CLIP-seq
MIRT2347384	hsa-miR-637	CLIP-seq
MIRT2347385	hsa-miR-650	CLIP-seq
MIRT2124939	hsa-miR-761	CLIP-seq
MIRT2347386	hsa-miR-892b	CLIP-seq
MIRT2347387	hsa-miR-940	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0019901	Function	Protein kinase binding	IPI	10983986
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035556	Process	Intracellular signal transduction	IDA	10983986
GO:0043539	Function	Protein serine/threonine kinase activator activity	IBA
GO:0043539	Function	Protein serine/threonine kinase activator activity	IDA	10983986
GO:0043539	Function	Protein serine/threonine kinase activator activity	IEA

Other IDs

• MIM: 603769
• HGNC: 11649
• e!Ensembl: ENSG00000213231

Protein

• UniProt ID: O95988
• Protein name: T-cell leukemia/lymphoma protein 1B (Oncogene TCL-1B) (Oncogene TCL1B) (SYN-1) (Syncytiotrophoblast-specific protein) (TCL1/MTCP1-like protein 1)
• Protein function: Enhances the phosphorylation and activation of AKT1 and AKT2.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01840	TCL1_MTCP1	1 → 124	TCL1/MTCP1 family	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in a variety of tissues including placenta and testis. {ECO:0000269|PubMed:10077617, ECO:0000269|PubMed:10344735}.
• Sequence:

  MASEASVRLGVPPGRLWIQRPGIYEDEEGRTWVTVVVRFNPSRREWARASQGSRYEPSIT
  VHLWQMAVHTRELLSSGQMPFSQLPAVWQLYPGRKYRAADSSFWEIADHGQIDSMEQLVL
  TYQPERKD

• Sequence length: 128

Pathways

KEGG:

PI3K-Akt signaling pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	15262434		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15262434		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	10786666, 20382409		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	10570904, 11607815, 8415691, 9407948, 9738977		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	30286151		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	25688912		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	11297767, 11857346, 12966431, 15262434, 7662982, 8570215, 8634440		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	11752899	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	10792782, 11304575, 11857346, 17260020, 19966860, 20382409, 22645177, 25688912, 26522720		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	16864779, 19064921, 20357824, 23160471, 26821067		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	20228224		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24083474, 27869804		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20228224	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	14607063, 16146820, 19966860, 29318382		★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	31781912		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	15262434		★☆☆☆☆ Found in Text Mining only
Chronic leukemia (category)	Leukemia	BEFREE	8415691		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	12011454, 15661260, 16341048, 16424025, 16670263, 16864779, 17178851, 17707831, 19064921, 19168795, 19179304, 19332800, 19666576, 19726084, 19889012, 19901553, 20357824, 20581456, 20863894, 20936047, 21098398, 21130495, 21753157, 22001392, 22065599, 22460735, 22692508, 22743622, 23034282, 23160471, 23547049, 23608884, 23863897, 24014303, 24022692, 24100449, 24311722, 24379361, 25482129, 25564405, 25646413, 26041471, 26522085, 26821067, 27071132, 27284738, 27556692, 27655686, 27815263, 27843137, 27903679, 28465341, 28783166, 29099493, 29173971, 29296862, 29317454, 29650518, 29695515, 30093506, 30262843, 30267008, 30457982, 30468254, 30556925, 30573773, 30819907, 30987970, 31197259, 31315913, 31519123, 31537531, 31724172, 3282128		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	28194886		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	10786666, 12710944, 18162778, 19816150, 19966860, 20382409		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	9270031		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	22065599, 30151355		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	9738977		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	8415691		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10197596, 16670263, 16864779, 19064921, 19332800, 19901553, 20357824, 22001392, 22065599, 23118218, 23160471, 23608884, 24100449, 24379361, 25564405, 25646413, 26821067, 27815263, 28783166, 29317454, 30457982, 7662982, 9520462, 9892178		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	23940084		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	10077617, 10197596, 10449776, 10792782, 10851082, 11304575, 11607815, 11710897, 12009899, 12011454, 12562214, 12710944, 12962701, 15262434, 15661260, 16146820, 16908353, 17890451, 18162778, 19064921, 19147787, 19889012, 20357824, 22065599, 22645177, 23160471, 24379361, 24668151, 25646413, 25688912, 26041471, 27071132, 27556692, 30151355, 7662982, 7809072, 7987816, 8415691, 9407948, 9520462, 9738977		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24352616		★☆☆☆☆ Found in Text Mining only
Lymphocytosis	Lymphocytosis	BEFREE	24379361		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10449776, 10792782, 11304575, 16146820, 17548807, 19147787, 23160471, 24668151, 26522720, 7809072		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	22645177		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	17151114		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	17151114		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	16424025, 16864779		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	25688912		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	20228224		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24083474, 27869804		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11857346, 12962701, 16424025, 19332800, 19717643, 22645177, 23160471, 24083474, 25486566, 7662982, 7809072, 7987816, 9738977		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	9270031		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	20228224		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	20228224		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	20228224		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	25688912		★☆☆☆☆ Found in Text Mining only
Mediastinal (Thymic) Large B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	20382409		★☆☆☆☆ Found in Text Mining only
Medulloblastoma with extensive nodularity	Medulloblastoma With Extensive Nodularity	BEFREE	31781912		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	24722758		★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	10792782		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	11304575, 9738977		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	26494558		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10449776, 10786666, 12009899, 12011454, 16341048, 17260020, 17890451, 18792075, 20936047, 22645177, 22743622, 22895265, 23547049, 27869804, 28232160, 29227814, 30262843, 8415691, 9520462, 9614908, 9639427		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	BEFREE	9270031		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	25475535		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	CTD_human_DG	25475535		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	18628085, 9639427		★☆☆☆☆ Found in Text Mining only
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	12127395		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	10786666		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	25486566		★☆☆☆☆ Found in Text Mining only
Rectal Prolapse	Rectal Prolapse	BEFREE	30457982		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	12002387		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	9270031		★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	8759778		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	10786666		★☆☆☆☆ Found in Text Mining only
T-Cell Prolymphocytic Leukemia	T-Cell Prolymphocytic Leukemia	BEFREE	10197596, 10786666, 11054065, 17890451, 18073348, 22065599, 23160471, 24446122, 26379148, 28194886, 28232160, 28821581, 29449575, 8634440, 9657733		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	30305637		★☆☆☆☆ Found in Text Mining only