Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9618
Gene name	TNF receptor associated factor 4
Gene symbol	TRAF4
Synonyms (NCBI Gene)	CART1MLN62RNF83
Chromosome	17
Chromosome location	17q11.2
Summary	This gene encodes a member of the TNF receptor associated factor (TRAF) family. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. The encoded protein has been shown to interact with neurotroph

152

Show/Hide all (152)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051252	hsa-miR-16-5p	CLASH	23622248
MIRT049070	hsa-miR-92a-3p	CLASH	23622248
MIRT047104	hsa-miR-183-5p	CLASH	23622248
MIRT046838	hsa-miR-221-3p	CLASH	23622248
MIRT044793	hsa-miR-320a	CLASH	23622248
MIRT040479	hsa-miR-605-5p	CLASH	23622248
MIRT052844	hsa-miR-4284	CLASH	23622248
MIRT438257	hsa-miR-29a-3p	Luciferase reporter assay	24100420
MIRT438257	hsa-miR-29a-3p	Luciferase reporter assay	24100420
MIRT438257	hsa-miR-29a-3p	Luciferase reporter assay	24100420
MIRT438257	hsa-miR-29a-3p	Luciferase reporter assay	24100420
MIRT732882	hsa-miR-3612	Luciferase reporter assayWestern blottingImmunoprecipitaion (IP)qRT-PCRIn situ hybridization	32280300
MIRT733680	hsa-miR-4443	Luciferase reporter assayqRT-PCRWestern blotting	32337817
MIRT734556	hsa-miR-532-3p	Luciferase reporter assayWestern blotting	32368615
MIRT734597	hsa-miR-29a-5p	Luciferase reporter assay	33171493
MIRT734597	hsa-miR-29a-5p	Luciferase reporter assay	33171493
MIRT755471	hsa-miR-4723-5p	qRT-PCR	35382692
MIRT1450982	hsa-miR-1228	CLIP-seq
MIRT1450983	hsa-miR-194	CLIP-seq
MIRT1450984	hsa-miR-2114	CLIP-seq
MIRT1450985	hsa-miR-2355-5p	CLIP-seq
MIRT1450986	hsa-miR-2392	CLIP-seq
MIRT1450987	hsa-miR-3064-3p	CLIP-seq
MIRT1450988	hsa-miR-3130-5p	CLIP-seq
MIRT1450989	hsa-miR-3189-5p	CLIP-seq
MIRT1450990	hsa-miR-3605-5p	CLIP-seq
MIRT1450991	hsa-miR-3652	CLIP-seq
MIRT1450992	hsa-miR-3679-3p	CLIP-seq
MIRT1450993	hsa-miR-4286	CLIP-seq
MIRT1450994	hsa-miR-4292	CLIP-seq
MIRT1450995	hsa-miR-4308	CLIP-seq
MIRT1450996	hsa-miR-433	CLIP-seq
MIRT1450997	hsa-miR-4430	CLIP-seq
MIRT1450998	hsa-miR-4474-3p	CLIP-seq
MIRT1450999	hsa-miR-4482	CLIP-seq
MIRT1451000	hsa-miR-4505	CLIP-seq
MIRT1451001	hsa-miR-4715-3p	CLIP-seq
MIRT1451002	hsa-miR-4731-5p	CLIP-seq
MIRT1451003	hsa-miR-4758-3p	CLIP-seq
MIRT1451004	hsa-miR-4764-5p	CLIP-seq
MIRT1451005	hsa-miR-711	CLIP-seq
MIRT2134794	hsa-miR-298	CLIP-seq
MIRT2134795	hsa-miR-3136-5p	CLIP-seq
MIRT2134796	hsa-miR-3148	CLIP-seq
MIRT2134797	hsa-miR-4439	CLIP-seq
MIRT2134798	hsa-miR-4513	CLIP-seq
MIRT2134799	hsa-miR-4668-5p	CLIP-seq
MIRT2134800	hsa-miR-4676-5p	CLIP-seq
MIRT2134801	hsa-miR-4695-3p	CLIP-seq
MIRT2134802	hsa-miR-4716-3p	CLIP-seq
MIRT2134803	hsa-miR-4787-5p	CLIP-seq
MIRT2134804	hsa-miR-513c	CLIP-seq
MIRT2134805	hsa-miR-514b-5p	CLIP-seq
MIRT2134806	hsa-miR-548c-3p	CLIP-seq
MIRT2134807	hsa-miR-575	CLIP-seq
MIRT2134808	hsa-miR-615-5p	CLIP-seq
MIRT2134809	hsa-miR-625	CLIP-seq
MIRT2134810	hsa-miR-646	CLIP-seq
MIRT2134811	hsa-miR-922	CLIP-seq
MIRT2356070	hsa-miR-2682	CLIP-seq
MIRT2134794	hsa-miR-298	CLIP-seq
MIRT2356071	hsa-miR-29a	CLIP-seq
MIRT2356072	hsa-miR-29b	CLIP-seq
MIRT2356073	hsa-miR-29c	CLIP-seq
MIRT1450989	hsa-miR-3189-5p	CLIP-seq
MIRT2356074	hsa-miR-3622a-3p	CLIP-seq
MIRT2356075	hsa-miR-3622b-3p	CLIP-seq
MIRT2356076	hsa-miR-449c	CLIP-seq
MIRT2356077	hsa-miR-4640-5p	CLIP-seq
MIRT2356078	hsa-miR-4726-5p	CLIP-seq
MIRT1451003	hsa-miR-4758-3p	CLIP-seq
MIRT2134810	hsa-miR-646	CLIP-seq
MIRT2356079	hsa-miR-650	CLIP-seq
MIRT2134811	hsa-miR-922	CLIP-seq
MIRT2356080	hsa-miR-940	CLIP-seq
MIRT2356071	hsa-miR-29a	CLIP-seq
MIRT2356072	hsa-miR-29b	CLIP-seq
MIRT2356073	hsa-miR-29c	CLIP-seq
MIRT1450992	hsa-miR-3679-3p	CLIP-seq
MIRT2356077	hsa-miR-4640-5p	CLIP-seq
MIRT2356078	hsa-miR-4726-5p	CLIP-seq
MIRT2462274	hsa-miR-4313	CLIP-seq
MIRT2134803	hsa-miR-4787-5p	CLIP-seq
MIRT2134808	hsa-miR-615-5p	CLIP-seq
MIRT2649574	hsa-miR-1291	CLIP-seq
MIRT2649575	hsa-miR-129-3p	CLIP-seq
MIRT2649576	hsa-miR-1470	CLIP-seq
MIRT2649577	hsa-miR-1913	CLIP-seq
MIRT2649578	hsa-miR-3154	CLIP-seq
MIRT2649579	hsa-miR-3157-3p	CLIP-seq
MIRT2649580	hsa-miR-3162-3p	CLIP-seq
MIRT2649581	hsa-miR-3180-5p	CLIP-seq
MIRT2649582	hsa-miR-324-3p	CLIP-seq
MIRT2649583	hsa-miR-346	CLIP-seq
MIRT2649584	hsa-miR-3545-3p	CLIP-seq
MIRT2649585	hsa-miR-3614-5p	CLIP-seq
MIRT2649586	hsa-miR-3910	CLIP-seq
MIRT2649587	hsa-miR-4287	CLIP-seq
MIRT2649588	hsa-miR-4288	CLIP-seq
MIRT1450994	hsa-miR-4292	CLIP-seq
MIRT2649589	hsa-miR-4469	CLIP-seq
MIRT2649590	hsa-miR-4667-3p	CLIP-seq
MIRT2649591	hsa-miR-4685-3p	CLIP-seq
MIRT2649592	hsa-miR-4713-5p	CLIP-seq
MIRT2134808	hsa-miR-615-5p	CLIP-seq
MIRT2649593	hsa-miR-632	CLIP-seq
MIRT2649594	hsa-miR-654-3p	CLIP-seq
MIRT2694033	hsa-miR-1224-3p	CLIP-seq
MIRT2694034	hsa-miR-1260	CLIP-seq
MIRT2694035	hsa-miR-1260b	CLIP-seq
MIRT2694036	hsa-miR-1280	CLIP-seq
MIRT2649574	hsa-miR-1291	CLIP-seq
MIRT2649575	hsa-miR-129-3p	CLIP-seq
MIRT2694037	hsa-miR-1302	CLIP-seq
MIRT2694038	hsa-miR-135a	CLIP-seq
MIRT2694039	hsa-miR-135b	CLIP-seq
MIRT2649576	hsa-miR-1470	CLIP-seq
MIRT2694040	hsa-miR-188-3p	CLIP-seq
MIRT2649577	hsa-miR-1913	CLIP-seq
MIRT2356071	hsa-miR-29a	CLIP-seq
MIRT2356072	hsa-miR-29b	CLIP-seq
MIRT2356073	hsa-miR-29c	CLIP-seq
MIRT2694041	hsa-miR-3122	CLIP-seq
MIRT2649578	hsa-miR-3154	CLIP-seq
MIRT2694042	hsa-miR-3156-3p	CLIP-seq
MIRT2649579	hsa-miR-3157-3p	CLIP-seq
MIRT2649580	hsa-miR-3162-3p	CLIP-seq
MIRT2649581	hsa-miR-3180-5p	CLIP-seq
MIRT2649582	hsa-miR-324-3p	CLIP-seq
MIRT2649583	hsa-miR-346	CLIP-seq
MIRT2649584	hsa-miR-3545-3p	CLIP-seq
MIRT2649585	hsa-miR-3614-5p	CLIP-seq
MIRT2356074	hsa-miR-3622a-3p	CLIP-seq
MIRT2356075	hsa-miR-3622b-3p	CLIP-seq
MIRT2649586	hsa-miR-3910	CLIP-seq
MIRT2694043	hsa-miR-3913-5p	CLIP-seq
MIRT2649587	hsa-miR-4287	CLIP-seq
MIRT2649588	hsa-miR-4288	CLIP-seq
MIRT1450994	hsa-miR-4292	CLIP-seq
MIRT2694044	hsa-miR-4298	CLIP-seq
MIRT2694045	hsa-miR-4468	CLIP-seq
MIRT2649589	hsa-miR-4469	CLIP-seq
MIRT2694046	hsa-miR-4521	CLIP-seq
MIRT2694047	hsa-miR-4640-3p	CLIP-seq
MIRT2649590	hsa-miR-4667-3p	CLIP-seq
MIRT2649591	hsa-miR-4685-3p	CLIP-seq
MIRT2649592	hsa-miR-4713-5p	CLIP-seq
MIRT2134808	hsa-miR-615-5p	CLIP-seq
MIRT2649593	hsa-miR-632	CLIP-seq
MIRT2694048	hsa-miR-635	CLIP-seq
MIRT2649594	hsa-miR-654-3p	CLIP-seq
MIRT2694049	hsa-miR-760	CLIP-seq

Show/Hide all (41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001650	Component	Fibrillar center	IDA
GO:0002376	Process	Immune system process	IEA
GO:0005164	Function	Tumor necrosis factor receptor binding	IPI	11728344
GO:0005515	Function	Protein binding	IPI	10514511, 16157600, 16330715, 19937093, 21516116, 22014111, 22493164, 23455924, 25416956, 25910212, 26871637, 27107012, 28514442, 29892012, 31515488, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IDA	18087216
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	7592751
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	16157600
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005923	Component	Bicellular tight junction	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0007585	Process	Respiratory gaseous exchange by respiratory system	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019899	Function	Enzyme binding	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0030323	Process	Respiratory tube development	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	11279055
GO:0031996	Function	Thioesterase binding	IPI	11279055
GO:0035591	Function	Signaling adaptor activity	IBA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	24311986, 25416956, 27107012, 32296183
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043122	Process	Regulation of canonical NF-kappaB signal transduction	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045860	Process	Positive regulation of protein kinase activity	IDA	16157600
GO:0046330	Process	Positive regulation of JNK cascade	IDA	16157600
GO:0046330	Process	Positive regulation of JNK cascade	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050699	Function	WW domain binding	IPI	19937093
GO:0070161	Component	Anchoring junction	IEA

MIM	HGNC	e!Ensembl
602464	12034	ENSG00000076604

Q9BUZ4

Protein name

TNF receptor-associated factor 4 (EC 2.3.2.27) (Cysteine-rich domain associated with RING and Traf domains protein 1) (Metastatic lymph node gene 62 protein) (MLN 62) (RING finger protein 83)

Protein function

Adapter protein with E3 ligase activity that is involved in many diverse biological processes including cell proliferation, migration, differentiation, DNA repair, platelet activation or apoptosis (PubMed:30352854, PubMed:31076633, PubMed:322682

PDB

2EOD , 2YUC , 3ZJB , 4K8U , 4M4E , 5YC1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00097	zf-C3HC4	18 → 56	Zinc finger, C3HC4 type (RING finger)	Domain
PF02176	zf-TRAF	102 → 156	TRAF-type zinc finger	Family
PF02176	zf-TRAF	156 → 210	TRAF-type zinc finger	Family
PF02176	zf-TRAF	210 → 269	TRAF-type zinc finger	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in epithelial cells of thymus, dendritic cells of lymph node, and in the basal cell layer of epithelia such as epidermis, nasopharynx, respiratory tract, salivary gland, and esophagus. {ECO:0000269|PubMed:7592751, ECO:0000269

Sequence

MPGFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLP
LDYAKIYPDPELEVQVLGLPIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVIPCPNRCPMK
LSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGMCPQESVYCENKCGARMMRRLL
AQHATSECPKRTQPCTYCTKEFVFDTIQSHQYQCPRLPVACPNQCGVGTVAREDLPGHLK
DSCNTALVLCPFKDSGCKHRCPKLAMARHVEESVKPHLAMMCALVSRQRQELQELRRELE
ELSVGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEG
THLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKP
GTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRAAVELPRKILS

Sequence length

470

Interactions

View interactions

	KEGG
	IL-17 signaling pathway Pathways in cancer Small cell lung cancer

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BRAIN INJURIES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL TREMOR	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (59)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acrania	Acrania	BEFREE	8673125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	16799635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	28604663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	31553645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	31553645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	32268273	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16799635, 23388826, 23743189, 23973329, 24990246, 25591657, 25704480, 26331901, 29684350, 30015883, 7592751, 8752152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16969126, 33991522	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25704480, 25738361, 7592751, 9626059	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms Male	Male breast neoplasms	Pubtator	22527098	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	30933965	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16799635, 18087216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24154876, 28827764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	34983361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	8756334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	8756334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	21097508, 22547678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	30853613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	25681341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	30933965, 32065218	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Exencephaly	Anencephaly	BEFREE	19117321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	29499718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	36077559	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31257517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30186853, 30348972, 36077559	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	29163513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	23431243	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	23638224	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	29749456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28256185, 30087710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	29749456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	30348972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23388826, 23743189, 23973329, 24990246, 25591657, 25704480, 26331901, 29684350, 30015883, 8752152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	30853613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24154876, 28827764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24100420, 29715200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16799635, 25591657, 27842582, 28256185, 28827764, 29715200, 30186750, 30933965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16969126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	Pubtator	27086366	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Bone Disorder	Metabolic Bone Disorder	BEFREE	31076633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	24100420, 29715200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16799635, 23743189, 24100420, 24154876, 25270078, 26331901, 28256185, 28827764, 29684350, 30348972, 8756334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	15800852, 20932315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25976502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	31076633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	25270078, 25700355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	25700355	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36625999	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24100420, 29715200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	9626059	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	9626059	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spina Bifida Cystica	Spina Bifida Cystica	BEFREE	19117321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	28604663	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30933965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18087216	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26617938	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	18087216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35731212	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	32087604	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TRAF4 (TNF receptor associated factor 4)