Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9616
Gene name	Ring finger protein 7
Gene symbol	RNF7
Synonyms (NCBI Gene)	CKBBP1ROC2SAGrbx2
Chromosome	3
Chromosome location	3q23
Summary	The protein encoded by this gene is a highly conserved ring finger protein. It is an essential subunit of SKP1-cullin/CDC53-F box protein ubiquitin ligases, which are a part of the protein degradation machinery important for cell cycle progression and sig

386

Show/Hide all (386)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019231	hsa-miR-331-3p	Sequencing	20371350
MIRT439146	hsa-let-7c-5p	3'LIFE	25074381
MIRT439146	hsa-let-7c-5p	3'LIFE	25074381
MIRT1313647	hsa-miR-1183	CLIP-seq
MIRT1313648	hsa-miR-1293	CLIP-seq
MIRT1313649	hsa-miR-1827	CLIP-seq
MIRT1313650	hsa-miR-2110	CLIP-seq
MIRT1313651	hsa-miR-34b	CLIP-seq
MIRT1313652	hsa-miR-3614-5p	CLIP-seq
MIRT1313653	hsa-miR-3622a-3p	CLIP-seq
MIRT1313654	hsa-miR-3622b-3p	CLIP-seq
MIRT1313655	hsa-miR-3672	CLIP-seq
MIRT1313656	hsa-miR-3926	CLIP-seq
MIRT1313657	hsa-miR-3929	CLIP-seq
MIRT1313658	hsa-miR-4271	CLIP-seq
MIRT1313659	hsa-miR-4325	CLIP-seq
MIRT1313660	hsa-miR-4419b	CLIP-seq
MIRT1313661	hsa-miR-4433	CLIP-seq
MIRT1313662	hsa-miR-4459	CLIP-seq
MIRT1313663	hsa-miR-4478	CLIP-seq
MIRT1313664	hsa-miR-4483	CLIP-seq
MIRT1313665	hsa-miR-451b	CLIP-seq
MIRT1313666	hsa-miR-4649-3p	CLIP-seq
MIRT1313667	hsa-miR-4649-5p	CLIP-seq
MIRT1313668	hsa-miR-4693-5p	CLIP-seq
MIRT1313669	hsa-miR-4722-5p	CLIP-seq
MIRT1313670	hsa-miR-4725-3p	CLIP-seq
MIRT1313671	hsa-miR-4768-3p	CLIP-seq
MIRT1313672	hsa-miR-4786-5p	CLIP-seq
MIRT1313673	hsa-miR-4793-3p	CLIP-seq
MIRT1313674	hsa-miR-485-5p	CLIP-seq
MIRT1313675	hsa-miR-508-5p	CLIP-seq
MIRT1313676	hsa-miR-544b	CLIP-seq
MIRT1313677	hsa-miR-548g	CLIP-seq
MIRT1313678	hsa-miR-548s	CLIP-seq
MIRT1313679	hsa-miR-605	CLIP-seq
MIRT1313680	hsa-miR-658	CLIP-seq
MIRT1313681	hsa-miR-661	CLIP-seq
MIRT1313682	hsa-miR-766	CLIP-seq
MIRT1313683	hsa-miR-769-5p	CLIP-seq
MIRT1313684	hsa-miR-940	CLIP-seq
MIRT1313685	hsa-let-7a	CLIP-seq
MIRT1313686	hsa-let-7b	CLIP-seq
MIRT1313687	hsa-let-7c	CLIP-seq
MIRT1313688	hsa-let-7d	CLIP-seq
MIRT1313689	hsa-let-7e	CLIP-seq
MIRT1313690	hsa-let-7f	CLIP-seq
MIRT1313691	hsa-let-7g	CLIP-seq
MIRT1313692	hsa-let-7i	CLIP-seq
MIRT1313647	hsa-miR-1183	CLIP-seq
MIRT1313693	hsa-miR-1228	CLIP-seq
MIRT1313694	hsa-miR-1243	CLIP-seq
MIRT1313695	hsa-miR-140-3p	CLIP-seq
MIRT1313696	hsa-miR-142-3p	CLIP-seq
MIRT1313649	hsa-miR-1827	CLIP-seq
MIRT1313697	hsa-miR-194	CLIP-seq
MIRT1313698	hsa-miR-3143	CLIP-seq
MIRT1313699	hsa-miR-3174	CLIP-seq
MIRT1313700	hsa-miR-3185	CLIP-seq
MIRT1313701	hsa-miR-329	CLIP-seq
MIRT1313651	hsa-miR-34b	CLIP-seq
MIRT1313702	hsa-miR-3614-3p	CLIP-seq
MIRT1313652	hsa-miR-3614-5p	CLIP-seq
MIRT1313653	hsa-miR-3622a-3p	CLIP-seq
MIRT1313654	hsa-miR-3622b-3p	CLIP-seq
MIRT1313703	hsa-miR-362-3p	CLIP-seq
MIRT1313704	hsa-miR-3653	CLIP-seq
MIRT1313705	hsa-miR-3674	CLIP-seq
MIRT1313657	hsa-miR-3929	CLIP-seq
MIRT1313706	hsa-miR-3940-5p	CLIP-seq
MIRT1313707	hsa-miR-4255	CLIP-seq
MIRT1313708	hsa-miR-4257	CLIP-seq
MIRT1313709	hsa-miR-4259	CLIP-seq
MIRT1313659	hsa-miR-4325	CLIP-seq
MIRT1313660	hsa-miR-4419b	CLIP-seq
MIRT1313661	hsa-miR-4433	CLIP-seq
MIRT1313710	hsa-miR-4436b-3p	CLIP-seq
MIRT1313711	hsa-miR-4455	CLIP-seq
MIRT1313712	hsa-miR-4458	CLIP-seq
MIRT1313662	hsa-miR-4459	CLIP-seq
MIRT1313713	hsa-miR-4476	CLIP-seq
MIRT1313663	hsa-miR-4478	CLIP-seq
MIRT1313714	hsa-miR-4500	CLIP-seq
MIRT1313715	hsa-miR-4507	CLIP-seq
MIRT1313716	hsa-miR-4533	CLIP-seq
MIRT1313717	hsa-miR-4539	CLIP-seq
MIRT1313666	hsa-miR-4649-3p	CLIP-seq
MIRT1313667	hsa-miR-4649-5p	CLIP-seq
MIRT1313718	hsa-miR-4685-5p	CLIP-seq
MIRT1313668	hsa-miR-4693-5p	CLIP-seq
MIRT1313719	hsa-miR-4709-3p	CLIP-seq
MIRT1313669	hsa-miR-4722-5p	CLIP-seq
MIRT1313720	hsa-miR-4733-3p	CLIP-seq
MIRT1313721	hsa-miR-4760-3p	CLIP-seq
MIRT1313722	hsa-miR-4761-3p	CLIP-seq
MIRT1313671	hsa-miR-4768-3p	CLIP-seq
MIRT1313673	hsa-miR-4793-3p	CLIP-seq
MIRT1313674	hsa-miR-485-5p	CLIP-seq
MIRT1313723	hsa-miR-543	CLIP-seq
MIRT1313676	hsa-miR-544b	CLIP-seq
MIRT1313677	hsa-miR-548g	CLIP-seq
MIRT1313724	hsa-miR-629	CLIP-seq
MIRT1313680	hsa-miR-658	CLIP-seq
MIRT1313725	hsa-miR-760	CLIP-seq
MIRT1313684	hsa-miR-940	CLIP-seq
MIRT1313726	hsa-miR-98	CLIP-seq
MIRT1313693	hsa-miR-1228	CLIP-seq
MIRT1313648	hsa-miR-1293	CLIP-seq
MIRT1313695	hsa-miR-140-3p	CLIP-seq
MIRT1313649	hsa-miR-1827	CLIP-seq
MIRT1313699	hsa-miR-3174	CLIP-seq
MIRT1313701	hsa-miR-329	CLIP-seq
MIRT1313651	hsa-miR-34b	CLIP-seq
MIRT1313652	hsa-miR-3614-5p	CLIP-seq
MIRT1313703	hsa-miR-362-3p	CLIP-seq
MIRT1313657	hsa-miR-3929	CLIP-seq
MIRT1313706	hsa-miR-3940-5p	CLIP-seq
MIRT2093383	hsa-miR-4252	CLIP-seq
MIRT1313709	hsa-miR-4259	CLIP-seq
MIRT2093384	hsa-miR-4263	CLIP-seq
MIRT1313660	hsa-miR-4419b	CLIP-seq
MIRT1313711	hsa-miR-4455	CLIP-seq
MIRT1313663	hsa-miR-4478	CLIP-seq
MIRT1313664	hsa-miR-4483	CLIP-seq
MIRT1313715	hsa-miR-4507	CLIP-seq
MIRT1313665	hsa-miR-451b	CLIP-seq
MIRT1313666	hsa-miR-4649-3p	CLIP-seq
MIRT2093385	hsa-miR-4696	CLIP-seq
MIRT1313669	hsa-miR-4722-5p	CLIP-seq
MIRT1313721	hsa-miR-4760-3p	CLIP-seq
MIRT2093386	hsa-miR-4760-5p	CLIP-seq
MIRT1313671	hsa-miR-4768-3p	CLIP-seq
MIRT1313673	hsa-miR-4793-3p	CLIP-seq
MIRT1313674	hsa-miR-485-5p	CLIP-seq
MIRT1313675	hsa-miR-508-5p	CLIP-seq
MIRT2093387	hsa-miR-571	CLIP-seq
MIRT1313724	hsa-miR-629	CLIP-seq
MIRT1313680	hsa-miR-658	CLIP-seq
MIRT1313681	hsa-miR-661	CLIP-seq
MIRT1313682	hsa-miR-766	CLIP-seq
MIRT1313684	hsa-miR-940	CLIP-seq
MIRT2317908	hsa-miR-3913-3p	CLIP-seq
MIRT2093384	hsa-miR-4263	CLIP-seq
MIRT2317909	hsa-miR-489	CLIP-seq
MIRT2093387	hsa-miR-571	CLIP-seq
MIRT1313685	hsa-let-7a	CLIP-seq
MIRT1313686	hsa-let-7b	CLIP-seq
MIRT1313687	hsa-let-7c	CLIP-seq
MIRT1313688	hsa-let-7d	CLIP-seq
MIRT1313689	hsa-let-7e	CLIP-seq
MIRT1313690	hsa-let-7f	CLIP-seq
MIRT1313691	hsa-let-7g	CLIP-seq
MIRT1313692	hsa-let-7i	CLIP-seq
MIRT2317910	hsa-miR-1247	CLIP-seq
MIRT1313648	hsa-miR-1293	CLIP-seq
MIRT1313695	hsa-miR-140-3p	CLIP-seq
MIRT1313649	hsa-miR-1827	CLIP-seq
MIRT1313650	hsa-miR-2110	CLIP-seq
MIRT2317911	hsa-miR-3122	CLIP-seq
MIRT1313699	hsa-miR-3174	CLIP-seq
MIRT1313701	hsa-miR-329	CLIP-seq
MIRT1313651	hsa-miR-34b	CLIP-seq
MIRT1313652	hsa-miR-3614-5p	CLIP-seq
MIRT1313703	hsa-miR-362-3p	CLIP-seq
MIRT2317912	hsa-miR-3689a-3p	CLIP-seq
MIRT2317913	hsa-miR-3689c	CLIP-seq
MIRT2317914	hsa-miR-3913-5p	CLIP-seq
MIRT1313656	hsa-miR-3926	CLIP-seq
MIRT1313657	hsa-miR-3929	CLIP-seq
MIRT2093383	hsa-miR-4252	CLIP-seq
MIRT1313708	hsa-miR-4257	CLIP-seq
MIRT2093384	hsa-miR-4263	CLIP-seq
MIRT1313658	hsa-miR-4271	CLIP-seq
MIRT1313660	hsa-miR-4419b	CLIP-seq
MIRT1313711	hsa-miR-4455	CLIP-seq
MIRT1313712	hsa-miR-4458	CLIP-seq
MIRT1313713	hsa-miR-4476	CLIP-seq
MIRT1313663	hsa-miR-4478	CLIP-seq
MIRT1313664	hsa-miR-4483	CLIP-seq
MIRT1313714	hsa-miR-4500	CLIP-seq
MIRT1313716	hsa-miR-4533	CLIP-seq
MIRT1313666	hsa-miR-4649-3p	CLIP-seq
MIRT1313667	hsa-miR-4649-5p	CLIP-seq
MIRT2317915	hsa-miR-4684-5p	CLIP-seq
MIRT1313669	hsa-miR-4722-5p	CLIP-seq
MIRT1313670	hsa-miR-4725-3p	CLIP-seq
MIRT2317916	hsa-miR-4728-5p	CLIP-seq
MIRT1313671	hsa-miR-4768-3p	CLIP-seq
MIRT1313672	hsa-miR-4786-5p	CLIP-seq
MIRT1313673	hsa-miR-4793-3p	CLIP-seq
MIRT1313674	hsa-miR-485-5p	CLIP-seq
MIRT1313675	hsa-miR-508-5p	CLIP-seq
MIRT2317917	hsa-miR-541	CLIP-seq
MIRT1313678	hsa-miR-548s	CLIP-seq
MIRT2093387	hsa-miR-571	CLIP-seq
MIRT1313679	hsa-miR-605	CLIP-seq
MIRT2317918	hsa-miR-654-5p	CLIP-seq
MIRT1313680	hsa-miR-658	CLIP-seq
MIRT1313681	hsa-miR-661	CLIP-seq
MIRT1313682	hsa-miR-766	CLIP-seq
MIRT1313683	hsa-miR-769-5p	CLIP-seq
MIRT2317919	hsa-miR-933	CLIP-seq
MIRT1313684	hsa-miR-940	CLIP-seq
MIRT1313726	hsa-miR-98	CLIP-seq
MIRT1313693	hsa-miR-1228	CLIP-seq
MIRT1313694	hsa-miR-1243	CLIP-seq
MIRT2317910	hsa-miR-1247	CLIP-seq
MIRT1313648	hsa-miR-1293	CLIP-seq
MIRT1313695	hsa-miR-140-3p	CLIP-seq
MIRT1313696	hsa-miR-142-3p	CLIP-seq
MIRT2613569	hsa-miR-142-5p	CLIP-seq
MIRT1313649	hsa-miR-1827	CLIP-seq
MIRT1313650	hsa-miR-2110	CLIP-seq
MIRT2613570	hsa-miR-2115	CLIP-seq
MIRT2613571	hsa-miR-219-1-3p	CLIP-seq
MIRT2613572	hsa-miR-3074-3p	CLIP-seq
MIRT2317911	hsa-miR-3122	CLIP-seq
MIRT2613573	hsa-miR-3124-3p	CLIP-seq
MIRT2613574	hsa-miR-3136-3p	CLIP-seq
MIRT1313699	hsa-miR-3174	CLIP-seq
MIRT1313700	hsa-miR-3185	CLIP-seq
MIRT2613575	hsa-miR-320e	CLIP-seq
MIRT1313701	hsa-miR-329	CLIP-seq
MIRT2613576	hsa-miR-340	CLIP-seq
MIRT1313651	hsa-miR-34b	CLIP-seq
MIRT2613577	hsa-miR-3613-5p	CLIP-seq
MIRT1313702	hsa-miR-3614-3p	CLIP-seq
MIRT1313652	hsa-miR-3614-5p	CLIP-seq
MIRT1313653	hsa-miR-3622a-3p	CLIP-seq
MIRT1313654	hsa-miR-3622b-3p	CLIP-seq
MIRT1313703	hsa-miR-362-3p	CLIP-seq
MIRT1313704	hsa-miR-3653	CLIP-seq
MIRT1313655	hsa-miR-3672	CLIP-seq
MIRT1313705	hsa-miR-3674	CLIP-seq
MIRT2317912	hsa-miR-3689a-3p	CLIP-seq
MIRT2317913	hsa-miR-3689c	CLIP-seq
MIRT2317914	hsa-miR-3913-5p	CLIP-seq
MIRT1313656	hsa-miR-3926	CLIP-seq
MIRT1313657	hsa-miR-3929	CLIP-seq
MIRT2093383	hsa-miR-4252	CLIP-seq
MIRT1313707	hsa-miR-4255	CLIP-seq
MIRT2093384	hsa-miR-4263	CLIP-seq
MIRT1313658	hsa-miR-4271	CLIP-seq
MIRT2613578	hsa-miR-4287	CLIP-seq
MIRT1313660	hsa-miR-4419b	CLIP-seq
MIRT1313661	hsa-miR-4433	CLIP-seq
MIRT1313710	hsa-miR-4436b-3p	CLIP-seq
MIRT2613579	hsa-miR-4436b-5p	CLIP-seq
MIRT1313711	hsa-miR-4455	CLIP-seq
MIRT1313662	hsa-miR-4459	CLIP-seq
MIRT2613580	hsa-miR-4469	CLIP-seq
MIRT1313663	hsa-miR-4478	CLIP-seq
MIRT1313664	hsa-miR-4483	CLIP-seq
MIRT2613581	hsa-miR-4484	CLIP-seq
MIRT2613582	hsa-miR-4506	CLIP-seq
MIRT1313665	hsa-miR-451b	CLIP-seq
MIRT1313717	hsa-miR-4539	CLIP-seq
MIRT2613583	hsa-miR-4633-3p	CLIP-seq
MIRT1313667	hsa-miR-4649-5p	CLIP-seq
MIRT2613584	hsa-miR-4668-3p	CLIP-seq
MIRT2317915	hsa-miR-4684-5p	CLIP-seq
MIRT2613585	hsa-miR-4685-3p	CLIP-seq
MIRT1313718	hsa-miR-4685-5p	CLIP-seq
MIRT2093385	hsa-miR-4696	CLIP-seq
MIRT2613586	hsa-miR-4698	CLIP-seq
MIRT1313719	hsa-miR-4709-3p	CLIP-seq
MIRT2613587	hsa-miR-4722-3p	CLIP-seq
MIRT1313669	hsa-miR-4722-5p	CLIP-seq
MIRT1313670	hsa-miR-4725-3p	CLIP-seq
MIRT2317916	hsa-miR-4728-5p	CLIP-seq
MIRT1313720	hsa-miR-4733-3p	CLIP-seq
MIRT2613588	hsa-miR-4738-3p	CLIP-seq
MIRT1313721	hsa-miR-4760-3p	CLIP-seq
MIRT1313722	hsa-miR-4761-3p	CLIP-seq
MIRT1313671	hsa-miR-4768-3p	CLIP-seq
MIRT1313672	hsa-miR-4786-5p	CLIP-seq
MIRT1313673	hsa-miR-4793-3p	CLIP-seq
MIRT1313674	hsa-miR-485-5p	CLIP-seq
MIRT2613589	hsa-miR-490-5p	CLIP-seq
MIRT2613590	hsa-miR-500a	CLIP-seq
MIRT1313675	hsa-miR-508-5p	CLIP-seq
MIRT2613591	hsa-miR-516a-3p	CLIP-seq
MIRT2317917	hsa-miR-541	CLIP-seq
MIRT1313676	hsa-miR-544b	CLIP-seq
MIRT2613592	hsa-miR-548an	CLIP-seq
MIRT2613593	hsa-miR-548c-3p	CLIP-seq
MIRT2613594	hsa-miR-548m	CLIP-seq
MIRT1313678	hsa-miR-548s	CLIP-seq
MIRT2613595	hsa-miR-555	CLIP-seq
MIRT2613596	hsa-miR-568	CLIP-seq
MIRT2093387	hsa-miR-571	CLIP-seq
MIRT1313679	hsa-miR-605	CLIP-seq
MIRT2613597	hsa-miR-642a	CLIP-seq
MIRT2317918	hsa-miR-654-5p	CLIP-seq
MIRT1313680	hsa-miR-658	CLIP-seq
MIRT1313681	hsa-miR-661	CLIP-seq
MIRT1313725	hsa-miR-760	CLIP-seq
MIRT1313682	hsa-miR-766	CLIP-seq
MIRT1313683	hsa-miR-769-5p	CLIP-seq
MIRT2613598	hsa-miR-802	CLIP-seq
MIRT2317919	hsa-miR-933	CLIP-seq
MIRT1313684	hsa-miR-940	CLIP-seq
MIRT1313693	hsa-miR-1228	CLIP-seq
MIRT1313694	hsa-miR-1243	CLIP-seq
MIRT2317910	hsa-miR-1247	CLIP-seq
MIRT1313648	hsa-miR-1293	CLIP-seq
MIRT1313695	hsa-miR-140-3p	CLIP-seq
MIRT1313696	hsa-miR-142-3p	CLIP-seq
MIRT2613569	hsa-miR-142-5p	CLIP-seq
MIRT1313649	hsa-miR-1827	CLIP-seq
MIRT1313650	hsa-miR-2110	CLIP-seq
MIRT2613570	hsa-miR-2115	CLIP-seq
MIRT2613571	hsa-miR-219-1-3p	CLIP-seq
MIRT2317911	hsa-miR-3122	CLIP-seq
MIRT2613573	hsa-miR-3124-3p	CLIP-seq
MIRT1313699	hsa-miR-3174	CLIP-seq
MIRT1313700	hsa-miR-3185	CLIP-seq
MIRT2613575	hsa-miR-320e	CLIP-seq
MIRT1313701	hsa-miR-329	CLIP-seq
MIRT2613576	hsa-miR-340	CLIP-seq
MIRT1313651	hsa-miR-34b	CLIP-seq
MIRT2613577	hsa-miR-3613-5p	CLIP-seq
MIRT1313702	hsa-miR-3614-3p	CLIP-seq
MIRT1313652	hsa-miR-3614-5p	CLIP-seq
MIRT1313653	hsa-miR-3622a-3p	CLIP-seq
MIRT1313654	hsa-miR-3622b-3p	CLIP-seq
MIRT1313703	hsa-miR-362-3p	CLIP-seq
MIRT1313655	hsa-miR-3672	CLIP-seq
MIRT1313705	hsa-miR-3674	CLIP-seq
MIRT2317912	hsa-miR-3689a-3p	CLIP-seq
MIRT2317913	hsa-miR-3689c	CLIP-seq
MIRT2317914	hsa-miR-3913-5p	CLIP-seq
MIRT1313656	hsa-miR-3926	CLIP-seq
MIRT1313657	hsa-miR-3929	CLIP-seq
MIRT2093383	hsa-miR-4252	CLIP-seq
MIRT1313707	hsa-miR-4255	CLIP-seq
MIRT2093384	hsa-miR-4263	CLIP-seq
MIRT1313658	hsa-miR-4271	CLIP-seq
MIRT1313660	hsa-miR-4419b	CLIP-seq
MIRT1313661	hsa-miR-4433	CLIP-seq
MIRT1313710	hsa-miR-4436b-3p	CLIP-seq
MIRT2613579	hsa-miR-4436b-5p	CLIP-seq
MIRT1313711	hsa-miR-4455	CLIP-seq
MIRT1313662	hsa-miR-4459	CLIP-seq
MIRT1313663	hsa-miR-4478	CLIP-seq
MIRT1313664	hsa-miR-4483	CLIP-seq
MIRT2613582	hsa-miR-4506	CLIP-seq
MIRT1313665	hsa-miR-451b	CLIP-seq
MIRT1313717	hsa-miR-4539	CLIP-seq
MIRT2613583	hsa-miR-4633-3p	CLIP-seq
MIRT1313667	hsa-miR-4649-5p	CLIP-seq
MIRT2317915	hsa-miR-4684-5p	CLIP-seq
MIRT1313718	hsa-miR-4685-5p	CLIP-seq
MIRT2093385	hsa-miR-4696	CLIP-seq
MIRT2613586	hsa-miR-4698	CLIP-seq
MIRT1313719	hsa-miR-4709-3p	CLIP-seq
MIRT1313669	hsa-miR-4722-5p	CLIP-seq
MIRT1313670	hsa-miR-4725-3p	CLIP-seq
MIRT2317916	hsa-miR-4728-5p	CLIP-seq
MIRT1313720	hsa-miR-4733-3p	CLIP-seq
MIRT2613588	hsa-miR-4738-3p	CLIP-seq
MIRT1313721	hsa-miR-4760-3p	CLIP-seq
MIRT1313722	hsa-miR-4761-3p	CLIP-seq
MIRT1313671	hsa-miR-4768-3p	CLIP-seq
MIRT1313672	hsa-miR-4786-5p	CLIP-seq
MIRT1313673	hsa-miR-4793-3p	CLIP-seq
MIRT1313674	hsa-miR-485-5p	CLIP-seq
MIRT1313675	hsa-miR-508-5p	CLIP-seq
MIRT2613591	hsa-miR-516a-3p	CLIP-seq
MIRT2317917	hsa-miR-541	CLIP-seq
MIRT1313676	hsa-miR-544b	CLIP-seq
MIRT2613593	hsa-miR-548c-3p	CLIP-seq
MIRT2613594	hsa-miR-548m	CLIP-seq
MIRT1313678	hsa-miR-548s	CLIP-seq
MIRT2613595	hsa-miR-555	CLIP-seq
MIRT2613596	hsa-miR-568	CLIP-seq
MIRT2093387	hsa-miR-571	CLIP-seq
MIRT1313679	hsa-miR-605	CLIP-seq
MIRT2317918	hsa-miR-654-5p	CLIP-seq
MIRT1313680	hsa-miR-658	CLIP-seq
MIRT1313681	hsa-miR-661	CLIP-seq
MIRT1313725	hsa-miR-760	CLIP-seq
MIRT1313682	hsa-miR-766	CLIP-seq
MIRT1313683	hsa-miR-769-5p	CLIP-seq
MIRT2317919	hsa-miR-933	CLIP-seq
MIRT1313684	hsa-miR-940	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
NR4A1	Repression	22159226

Show/Hide all (62)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001837	Process	Epithelial to mesenchymal transition	IDA	16096638
GO:0005507	Function	Copper ion binding	TAS	10082581
GO:0005515	Function	Protein binding	IPI	16325183, 19250909, 20098747, 21145461, 21516116, 22190034, 25416956, 26030842, 26906416, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	16874460
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	10082581
GO:0005634	Component	Nucleus	TAS	10082581
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	16874460
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	NAS	10082581
GO:0005737	Component	Cytoplasm	TAS	10082581
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	TAS	10082581
GO:0010498	Process	Proteasomal protein catabolic process	IDA	29033132
GO:0016567	Process	Protein ubiquitination	IBA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016567	Process	Protein ubiquitination	NAS	35293963
GO:0016740	Function	Transferase activity	IEA
GO:0019788	Function	NEDD8 transferase activity	TAS
GO:0021819	Process	Layer formation in cerebral cortex	ISS
GO:0030335	Process	Positive regulation of cell migration	NAS	33999101, 35293963
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IDA	31387940
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IDA	22017875, 22017876, 22017877
GO:0031466	Component	Cul5-RING ubiquitin ligase complex	IBA
GO:0031466	Component	Cul5-RING ubiquitin ligase complex	IDA	21980433, 22405651, 25505247, 31387940, 33268465, 34518685, 35512830, 38418882, 38574733
GO:0031466	Component	Cul5-RING ubiquitin ligase complex	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0038026	Process	Reelin-mediated signaling pathway	ISS
GO:0038162	Process	Erythropoietin-mediated signaling pathway	IDA	2163696, 9657743
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	11781573, 21980433, 22190037, 31253590, 31387940
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	21980433, 22190037, 27910872, 31387940, 33268465, 34518685, 35512830, 38574733
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	ISS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	NAS	33999101
GO:0043687	Process	Post-translational protein modification	TAS
GO:0045087	Process	Innate immune response	IDA	22915799
GO:0045116	Process	Protein neddylation	IDA	19250909
GO:0046314	Process	Phosphocreatine biosynthetic process	IDA	8186255
GO:0046872	Function	Metal ion binding	IEA
GO:0051607	Process	Defense response to virus	IDA	22915799
GO:0051775	Process	Response to redox state	TAS	10082581
GO:0051894	Process	Positive regulation of focal adhesion assembly	IMP	35512830
GO:0051895	Process	Negative regulation of focal adhesion assembly	IDA	35512830
GO:0060396	Process	Growth hormone receptor signaling pathway	IDA	2825030
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	IDA	12552091, 15690087
GO:0060400	Process	Negative regulation of growth hormone receptor signaling pathway	IDA	21980433
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	16874460, 22190037, 27910872, 31387940, 33268465, 34518685, 35512830, 38574733
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0061663	Function	NEDD8 ligase activity	IDA	19250909, 23300442
GO:0070979	Process	Protein K11-linked ubiquitination	IDA	27910872, 38574733
GO:0097602	Function	Cullin family protein binding	IBA
GO:0097602	Function	Cullin family protein binding	IDA	10230407
GO:0120184	Process	Negative regulation of focal adhesion disassembly	NAS	26598620
GO:0140896	Process	CGAS/STING signaling pathway	IDA	30842659, 30842662, 32911482, 32912999
GO:2001222	Process	Regulation of neuron migration	ISS

MIM	HGNC	e!Ensembl
603863	10070	ENSG00000114125

Q9UBF6

Protein name

RING-box protein 2 (Rbx2) (EC 2.3.2.27) (EC 2.3.2.32) (CKII beta-binding protein 1) (CKBBP1) (RING finger protein 7) (Regulator of cullins 2) (Sensitive to apoptosis gene protein)

Protein function

Catalytic component of multiple cullin-5-RING E3 ubiquitin-protein ligase complexes (ECS complexes), which mediate the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed:21980433, PubMed:33268465, PubMed:38418882, P

PDB

2ECL , 7ONI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12678	zf-rbx1	48 → 103	RING-H2 zinc finger domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in heart, liver, skeletal muscle and pancreas. At very low levels expressed in brain, placenta and lung. {ECO:0000269|PubMed:10512750}.

Sequence

MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDA
CLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK

Sequence length

113

Interactions

View interactions

	KEGG		Reactome
	Ubiquitin mediated proteolysis Human immunodeficiency virus 1 infection		Neddylation Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CIRRHOSIS OF LIVER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (119)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Autoimmune Diseases	Autoimmune disease	Pubtator	16030131	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	LHGDN	18685727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	18685727	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31926110	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28252001, 31926110, 36644576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31011256	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	16905685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Chorioretinal atrophy	Chorioretinal atrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	28338112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28670488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conductive hearing loss	Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cone-rod synaptic disorder, congenital nonprogressive	Congenital stationary night blindness	CTD_human_DG	7670478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of penis	Congenital Hypoplasia Of Penis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital stationary night blindness	Congenital stationary night blindness	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30389514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	36743388	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	17455800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	24951827	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	9244304	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	24951827	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Diverticulitis	Diverticulitis	BEFREE	28543263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	36497178	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	34082605	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	8824716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28338112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	31674730	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28442265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemeralopia	Hemeralopia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	22841784	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	28860020	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	29107429, 29257216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	30389514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	Pubtator	22665972	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoplasia of optic disc	Hypoplasia Of Optic Disc	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	23122428	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	8739566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile polyposis syndrome	Polyposis Syndrome	BEFREE	25619753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	30389514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29846044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	GWASDB_DG	22841784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	GWASCAT_DG	22841784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	28338112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	28338112, 28860020	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23122428, 24299561	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	22665972	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27672740, 28252001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	19446844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	19950419	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenic Syndromes Congenital	Myasthenic syndrome	Pubtator	39913008	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20103673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Night blindness congenital stationary	Night blindness, congenital stationary	Pubtator	22665972, 34781300	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Night blindness, congenital stationary	Night blindness	BEFREE	18175313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Night blindness, congenital stationary	Night blindness	ORPHANET_DG	19578023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Night blindness, congenital stationary	Night blindness	CTD_human_DG	7670478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Night blindness, congenital stationary	Night blindness	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Night blindness, congenital stationary	Night blindness	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Night blindness, congenital stationary, type 1	Night blindness	CTD_human_DG	7670478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Night Blindness, Congenital Stationary, Type 1A	Night blindness	CTD_human_DG	7670478		★★★★★ ★☆☆☆☆ Found in Text Mining only
NIGHT BLINDNESS, CONGENITAL STATIONARY, TYPE 1B	Night blindness	CTD_human_DG	7670478		★★★★★ ★☆☆☆☆ Found in Text Mining only
NIGHT BLINDNESS, CONGENITAL STATIONARY, TYPE 2A	Night blindness	CTD_human_DG	7670478		★★★★★ ★☆☆☆☆ Found in Text Mining only
NIGHT BLINDNESS, CONGENITAL STATIONARY, TYPE 2B (disorder)	Night blindness	CTD_human_DG	7670478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nyctalopia	Nyctalopia	BEFREE	30711028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nyctalopia	Nyctalopia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Oguchi disease	Oguchi Disease	BEFREE	15295660, 17200654, 18175313, 21447990, 22419846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oguchi disease	Oguchi Disease	ORPHANET_DG	15295660, 22419846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oguchi disease	Oguchi Disease	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Oguchi disease	Oguchi disease	Pubtator	17200654, 22419846, 22665972, 35246075, 35549688, 39913008	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oguchi disease	Oguchi Disease	CTD_human_DG	7670478, 9565049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oguchi disease	Oguchi Disease	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Oguchi Disease 1	Oguchi disease	CTD_human_DG	7670478, 9565049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oguchi Disease 1	Oguchi disease	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Oguchi Disease 1	Oguchi disease	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Oncocytoma, renal	Oncocytoma of kidney	BEFREE	30389514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic Atrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Oxyphilic Adenoma	Oxyphilic Adenoma	BEFREE	30389514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	36644576	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pharyngitis	Pharyngitis	BEFREE	21251553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pineal Gland Neoplasm	Pineal Gland Neoplasm	BEFREE	20418777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	34477128	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polydactyly	Polydactyly	BEFREE	27801979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	17236194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27672740, 28252001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28252001, 34897998	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	28860020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	29194363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30389514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Degeneration	Retinal degeneration	Pubtator	26848019	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	LHGDN	15232620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	18175313, 28549094, 29305604, 3872115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis pigmentosa	Retinitis Pigmentosa	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis pigmentosa	Pubtator	25268133, 28549094, 29305604	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	CTD_human_DG	9565049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
RETINITIS PIGMENTOSA 47	Retinitis Pigmentosa	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
RETINITIS PIGMENTOSA 47	Retinitis Pigmentosa	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
RETINITIS PIGMENTOSA 47	Retinitis Pigmentosa	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	28232133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhegmatogenous Retinal Detachment Autosomal Dominant	Rhegmatogenous retinal detachment	Pubtator	29641463	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rod-Cone Dystrophy	Rod-cone dystrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe myopia	Myopia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	36497178	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Toxic Shock Syndrome	Toxic Shock Syndrome	BEFREE	12508149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	31591086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	10759778	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	CTD_human_DG	8407215		★★★★★ ★☆☆☆☆ Found in Text Mining only
X-Linked Csnb	Congenital stationary night blindness, X-Linked	CTD_human_DG	7670478		★★★★★ ★☆☆☆☆ Found in Text Mining only

RNF7 (ring finger protein 7)