Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9612
Gene name	Nuclear receptor corepressor 2
Gene symbol	NCOR2
Synonyms (NCBI Gene)	CTG26N-CoR2SMAP270SMRTSMRTESMRTE-tauTNRC14TRACTRAC-1TRAC1
Chromosome	12
Chromosome location	12q24.31
Summary	This gene encodes a nuclear receptor co-repressor that mediates transcriptional silencing of certain target genes. The encoded protein is a member of a family of thyroid hormone- and retinoic acid receptor-associated co-repressors. This protein acts as pa

234

Show/Hide all (234)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005454	hsa-miR-10a-5p	qRT-PCRWestern blot	21212796
MIRT005455	hsa-miR-10b-5p	qRT-PCRWestern blot	21212796
MIRT006651	hsa-miR-16-5p	Luciferase reporter assay	22292036
MIRT006651	hsa-miR-16-5p	Luciferase reporter assay	22292036
MIRT021376	hsa-miR-9-5p	Microarray	17612493
MIRT050519	hsa-miR-20a-5p	CLASH	23622248
MIRT038284	hsa-miR-130b-5p	CLASH	23622248
MIRT035758	hsa-miR-2110	CLASH	23622248
MIRT053093	hsa-miR-125b-5p	Luciferase reporter assayWestern blot	23514806
MIRT054500	hsa-miR-100-5p	ImmunoblotImmunohistochemistryLuciferase reporter assayqRT-PCR	24244722
MIRT054824	hsa-miR-30c-5p	qRT-PCRWestern blot	24623846
0	hsa-miR-30c-5p	Luciferase reporter assayqRT-PCRWestern blot	24623846
0	hsa-miR-30c-5p	Luciferase reporter assayqRT-PCRWestern blot	24623846
MIRT487147	hsa-miR-1321	PAR-CLIP	23592263
MIRT487148	hsa-miR-4739	PAR-CLIP	23592263
MIRT487146	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT487145	hsa-miR-6871-5p	PAR-CLIP	23592263
MIRT487144	hsa-miR-6087	PAR-CLIP	23592263
MIRT487143	hsa-miR-4419a	PAR-CLIP	23592263
MIRT487142	hsa-miR-4510	PAR-CLIP	23592263
MIRT487141	hsa-miR-6127	PAR-CLIP	23592263
MIRT487140	hsa-miR-6129	PAR-CLIP	23592263
MIRT487139	hsa-miR-6130	PAR-CLIP	23592263
MIRT487138	hsa-miR-6133	PAR-CLIP	23592263
MIRT487137	hsa-miR-2277-5p	PAR-CLIP	23592263
MIRT487136	hsa-miR-658	PAR-CLIP	23592263
MIRT487135	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT487134	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT487133	hsa-miR-25-5p	PAR-CLIP	23592263
MIRT487132	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT487131	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT487130	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT487128	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT487129	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT487127	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT487126	hsa-miR-3178	PAR-CLIP	23592263
MIRT487125	hsa-miR-1273h-5p	PAR-CLIP	23592263
MIRT487124	hsa-miR-30b-3p	PAR-CLIP	23592263
MIRT487123	hsa-miR-3689a-3p	PAR-CLIP	23592263
MIRT487122	hsa-miR-3689b-3p	PAR-CLIP	23592263
MIRT487121	hsa-miR-3689c	PAR-CLIP	23592263
MIRT487120	hsa-miR-6779-5p	PAR-CLIP	23592263
MIRT487119	hsa-miR-6780a-5p	PAR-CLIP	23592263
MIRT487117	hsa-miR-4459	PAR-CLIP	23592263
MIRT487118	hsa-miR-6757-5p	PAR-CLIP	23592263
MIRT005455	hsa-miR-10b-5p	3'LIFE	25074381
MIRT727096	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT727095	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT006651	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT727094	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT005455	hsa-miR-10b-5p	3'LIFE	25074381
MIRT487147	hsa-miR-1321	PAR-CLIP	23592263
MIRT487148	hsa-miR-4739	PAR-CLIP	23592263
MIRT487146	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT487145	hsa-miR-6871-5p	PAR-CLIP	23592263
MIRT487144	hsa-miR-6087	PAR-CLIP	23592263
MIRT487143	hsa-miR-4419a	PAR-CLIP	23592263
MIRT487142	hsa-miR-4510	PAR-CLIP	23592263
MIRT487141	hsa-miR-6127	PAR-CLIP	23592263
MIRT487140	hsa-miR-6129	PAR-CLIP	23592263
MIRT487139	hsa-miR-6130	PAR-CLIP	23592263
MIRT487138	hsa-miR-6133	PAR-CLIP	23592263
MIRT487137	hsa-miR-2277-5p	PAR-CLIP	23592263
MIRT487136	hsa-miR-658	PAR-CLIP	23592263
MIRT487135	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT487134	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT487133	hsa-miR-25-5p	PAR-CLIP	23592263
MIRT487132	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT487131	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT487130	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT487128	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT487129	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT487127	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT487126	hsa-miR-3178	PAR-CLIP	23592263
MIRT487125	hsa-miR-1273h-5p	PAR-CLIP	23592263
MIRT487124	hsa-miR-30b-3p	PAR-CLIP	23592263
MIRT487123	hsa-miR-3689a-3p	PAR-CLIP	23592263
MIRT487122	hsa-miR-3689b-3p	PAR-CLIP	23592263
MIRT487121	hsa-miR-3689c	PAR-CLIP	23592263
MIRT487120	hsa-miR-6779-5p	PAR-CLIP	23592263
MIRT487119	hsa-miR-6780a-5p	PAR-CLIP	23592263
MIRT487117	hsa-miR-4459	PAR-CLIP	23592263
MIRT487118	hsa-miR-6757-5p	PAR-CLIP	23592263
MIRT1177571	hsa-miR-1193	CLIP-seq
MIRT1177572	hsa-miR-125a-5p	CLIP-seq
MIRT1177573	hsa-miR-125b	CLIP-seq
MIRT1177574	hsa-miR-1539	CLIP-seq
MIRT1177575	hsa-miR-15a	CLIP-seq
MIRT1177576	hsa-miR-15b	CLIP-seq
MIRT1177577	hsa-miR-16	CLIP-seq
MIRT1177578	hsa-miR-184	CLIP-seq
MIRT1177579	hsa-miR-195	CLIP-seq
MIRT1177580	hsa-miR-200b	CLIP-seq
MIRT1177581	hsa-miR-200c	CLIP-seq
MIRT1177582	hsa-miR-30a	CLIP-seq
MIRT1177583	hsa-miR-30b	CLIP-seq
MIRT1177584	hsa-miR-30c	CLIP-seq
MIRT1177585	hsa-miR-30d	CLIP-seq
MIRT1177586	hsa-miR-30e	CLIP-seq
MIRT1177587	hsa-miR-3130-3p	CLIP-seq
MIRT1177588	hsa-miR-3134	CLIP-seq
MIRT1177589	hsa-miR-3180	CLIP-seq
MIRT1177590	hsa-miR-3180-3p	CLIP-seq
MIRT1177591	hsa-miR-3194-5p	CLIP-seq
MIRT1177592	hsa-miR-3196	CLIP-seq
MIRT1177593	hsa-miR-331-3p	CLIP-seq
MIRT1177594	hsa-miR-3620	CLIP-seq
MIRT1177595	hsa-miR-3646	CLIP-seq
MIRT1177596	hsa-miR-378	CLIP-seq
MIRT1177597	hsa-miR-378b	CLIP-seq
MIRT1177598	hsa-miR-378c	CLIP-seq
MIRT1177599	hsa-miR-378d	CLIP-seq
MIRT1177600	hsa-miR-378e	CLIP-seq
MIRT1177601	hsa-miR-378f	CLIP-seq
MIRT1177602	hsa-miR-378h	CLIP-seq
MIRT1177603	hsa-miR-378i	CLIP-seq
MIRT1177604	hsa-miR-3918	CLIP-seq
MIRT1177605	hsa-miR-3940-3p	CLIP-seq
MIRT1177606	hsa-miR-3974	CLIP-seq
MIRT1177607	hsa-miR-422a	CLIP-seq
MIRT1177608	hsa-miR-424	CLIP-seq
MIRT1177609	hsa-miR-429	CLIP-seq
MIRT1177610	hsa-miR-4294	CLIP-seq
MIRT1177611	hsa-miR-4319	CLIP-seq
MIRT1177612	hsa-miR-4467	CLIP-seq
MIRT1177613	hsa-miR-4527	CLIP-seq
MIRT1177614	hsa-miR-4532	CLIP-seq
MIRT1177615	hsa-miR-4534	CLIP-seq
MIRT1177616	hsa-miR-4635	CLIP-seq
MIRT1177617	hsa-miR-4638-3p	CLIP-seq
MIRT1177618	hsa-miR-4640-5p	CLIP-seq
MIRT1177619	hsa-miR-4726-5p	CLIP-seq
MIRT1177620	hsa-miR-4756-3p	CLIP-seq
MIRT1177621	hsa-miR-4793-3p	CLIP-seq
MIRT1177622	hsa-miR-4804-5p	CLIP-seq
MIRT1177623	hsa-miR-497	CLIP-seq
MIRT1177624	hsa-miR-887	CLIP-seq
MIRT1177625	hsa-miR-924	CLIP-seq
MIRT1177571	hsa-miR-1193	CLIP-seq
MIRT1177626	hsa-miR-1234	CLIP-seq
MIRT1177627	hsa-miR-1266	CLIP-seq
MIRT1177574	hsa-miR-1539	CLIP-seq
MIRT1177575	hsa-miR-15a	CLIP-seq
MIRT1177576	hsa-miR-15b	CLIP-seq
MIRT1177577	hsa-miR-16	CLIP-seq
MIRT1177579	hsa-miR-195	CLIP-seq
MIRT1177580	hsa-miR-200b	CLIP-seq
MIRT1177581	hsa-miR-200c	CLIP-seq
MIRT1177588	hsa-miR-3134	CLIP-seq
MIRT1177628	hsa-miR-3189-3p	CLIP-seq
MIRT1177594	hsa-miR-3620	CLIP-seq
MIRT1177595	hsa-miR-3646	CLIP-seq
MIRT1177629	hsa-miR-3667-3p	CLIP-seq
MIRT1177608	hsa-miR-424	CLIP-seq
MIRT1177630	hsa-miR-4283	CLIP-seq
MIRT1177609	hsa-miR-429	CLIP-seq
MIRT1177631	hsa-miR-4448	CLIP-seq
MIRT1177615	hsa-miR-4534	CLIP-seq
MIRT1177616	hsa-miR-4635	CLIP-seq
MIRT1177620	hsa-miR-4756-3p	CLIP-seq
MIRT1177623	hsa-miR-497	CLIP-seq
MIRT1177632	hsa-miR-502-5p	CLIP-seq
MIRT1177633	hsa-miR-510	CLIP-seq
MIRT1177634	hsa-miR-555	CLIP-seq
MIRT1177635	hsa-miR-615-5p	CLIP-seq
MIRT1177624	hsa-miR-887	CLIP-seq
MIRT1177636	hsa-miR-1197	CLIP-seq
MIRT1177626	hsa-miR-1234	CLIP-seq
MIRT1177637	hsa-miR-1268	CLIP-seq
MIRT1177638	hsa-miR-1268b	CLIP-seq
MIRT1177575	hsa-miR-15a	CLIP-seq
MIRT1177576	hsa-miR-15b	CLIP-seq
MIRT1177577	hsa-miR-16	CLIP-seq
MIRT1177579	hsa-miR-195	CLIP-seq
MIRT1177580	hsa-miR-200b	CLIP-seq
MIRT1177581	hsa-miR-200c	CLIP-seq
MIRT1177629	hsa-miR-3667-3p	CLIP-seq
MIRT1177608	hsa-miR-424	CLIP-seq
MIRT1177609	hsa-miR-429	CLIP-seq
MIRT1177616	hsa-miR-4635	CLIP-seq
MIRT1177620	hsa-miR-4756-3p	CLIP-seq
MIRT1177639	hsa-miR-4781-5p	CLIP-seq
MIRT1177623	hsa-miR-497	CLIP-seq
MIRT1177634	hsa-miR-555	CLIP-seq
MIRT1177635	hsa-miR-615-5p	CLIP-seq
MIRT1177640	hsa-miR-744	CLIP-seq
MIRT1177624	hsa-miR-887	CLIP-seq
MIRT1177604	hsa-miR-3918	CLIP-seq
MIRT2051361	hsa-miR-1275	CLIP-seq
MIRT2051362	hsa-miR-133a	CLIP-seq
MIRT2051363	hsa-miR-133b	CLIP-seq
MIRT1177582	hsa-miR-30a	CLIP-seq
MIRT1177583	hsa-miR-30b	CLIP-seq
MIRT1177584	hsa-miR-30c	CLIP-seq
MIRT1177585	hsa-miR-30d	CLIP-seq
MIRT1177586	hsa-miR-30e	CLIP-seq
MIRT1177587	hsa-miR-3130-3p	CLIP-seq
MIRT1177589	hsa-miR-3180	CLIP-seq
MIRT1177590	hsa-miR-3180-3p	CLIP-seq
MIRT1177628	hsa-miR-3189-3p	CLIP-seq
MIRT1177591	hsa-miR-3194-5p	CLIP-seq
MIRT1177592	hsa-miR-3196	CLIP-seq
MIRT1177629	hsa-miR-3667-3p	CLIP-seq
MIRT1177604	hsa-miR-3918	CLIP-seq
MIRT1177605	hsa-miR-3940-3p	CLIP-seq
MIRT1177606	hsa-miR-3974	CLIP-seq
MIRT1177630	hsa-miR-4283	CLIP-seq
MIRT1177610	hsa-miR-4294	CLIP-seq
MIRT1177631	hsa-miR-4448	CLIP-seq
MIRT2051364	hsa-miR-4525	CLIP-seq
MIRT1177613	hsa-miR-4527	CLIP-seq
MIRT1177614	hsa-miR-4532	CLIP-seq
MIRT1177618	hsa-miR-4640-5p	CLIP-seq
MIRT2051365	hsa-miR-4665-5p	CLIP-seq
MIRT2051366	hsa-miR-4723-5p	CLIP-seq
MIRT1177619	hsa-miR-4726-5p	CLIP-seq
MIRT1177620	hsa-miR-4756-3p	CLIP-seq
MIRT2051367	hsa-miR-4760-3p	CLIP-seq
MIRT1177621	hsa-miR-4793-3p	CLIP-seq
MIRT1177632	hsa-miR-502-5p	CLIP-seq
MIRT2051368	hsa-miR-625	CLIP-seq
MIRT2051369	hsa-miR-664	CLIP-seq
MIRT1177625	hsa-miR-924	CLIP-seq
MIRT2280478	hsa-miR-3613-3p	CLIP-seq
MIRT1177629	hsa-miR-3667-3p	CLIP-seq
MIRT2051367	hsa-miR-4760-3p	CLIP-seq
MIRT2051362	hsa-miR-133a	CLIP-seq
MIRT2051363	hsa-miR-133b	CLIP-seq
MIRT1177574	hsa-miR-1539	CLIP-seq
MIRT2280479	hsa-miR-3193	CLIP-seq
MIRT1177616	hsa-miR-4635	CLIP-seq
MIRT2280480	hsa-miR-4765	CLIP-seq
MIRT1177635	hsa-miR-615-5p	CLIP-seq
MIRT1177624	hsa-miR-887	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
NFKB1	Unknown	17876798
RELA	Unknown	17876798
SPEN	Unknown	11331609

Show/Hide all (45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	10097068
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	12628926, 18052923, 19955185, 20388878
GO:0000785	Component	Chromatin	IBA
GO:0000785	Component	Chromatin	IDA	20388878
GO:0000785	Component	Chromatin	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0003714	Function	Transcription corepressor activity	IDA	18052923
GO:0003714	Function	Transcription corepressor activity	IEA
GO:0003714	Function	Transcription corepressor activity	IMP	12628926, 20812024
GO:0005112	Function	Notch binding	IPI	10713164
GO:0005515	Function	Protein binding	IPI	9605924, 10395741, 10713164, 10809664, 11013263, 11739383, 14985122, 15016912, 16129689, 16893456, 16924111, 16980585, 19786558, 20195357, 20467437, 20543827, 20812024, 20956942, 21240272, 21258344, 21475249, 21624135, 22230954, 23518351, 23752268, 24268649, 24449765, 25303530, 3034
GO:0005634	Component	Nucleus	IC	18052923
GO:0005634	Component	Nucleus	IDA	10097068, 12628926
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0007595	Process	Lactation	IEA
GO:0008047	Function	Enzyme activator activity	IDA	22230954
GO:0010565	Process	Regulation of ketone metabolic process	IEA
GO:0010565	Process	Regulation of ketone metabolic process	IMP	19955185
GO:0016020	Component	Membrane	HDA	19946888
GO:0016363	Component	Nuclear matrix	IDA	21328542
GO:0016604	Component	Nuclear body	IDA	16030140
GO:0016604	Component	Nuclear body	IEA
GO:0016922	Function	Nuclear receptor binding	IEA
GO:0017053	Component	Transcription repressor complex	IDA	11804585
GO:0021549	Process	Cerebellum development	IEA
GO:0032355	Process	Response to estradiol	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0035259	Function	Nuclear glucocorticoid receptor binding	IEA
GO:0042826	Function	Histone deacetylase binding	IEA
GO:0042826	Function	Histone deacetylase binding	IPI	11804585, 16924111
GO:0042974	Function	Nuclear retinoic acid receptor binding	IEA
GO:0044849	Process	Estrous cycle	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	20812024
GO:0046965	Function	Nuclear retinoid X receptor binding	IEA
GO:0060766	Process	Negative regulation of androgen receptor signaling pathway	IEA
GO:0060766	Process	Negative regulation of androgen receptor signaling pathway	IMP	20812024
GO:1902894	Process	Negative regulation of miRNA transcription	IEA
GO:1902894	Process	Negative regulation of miRNA transcription	IMP	20388878

MIM	HGNC	e!Ensembl
600848	7673	ENSG00000196498

Q9Y618

Protein name

Nuclear receptor corepressor 2 (N-CoR2) (CTG repeat protein 26) (SMAP270) (Silencing mediator of retinoic acid and thyroid hormone receptor) (SMRT) (T3 receptor-associating factor) (TRAC) (Thyroid-, retinoic-acid-receptor-associated corepressor)

Protein function

Transcriptional corepressor that mediates the transcriptional repression activity of some nuclear receptors by promoting chromatin condensation, thus preventing access of the basal transcription (PubMed:10077563, PubMed:10097068, PubMed:18212045

PDB

1KKQ , 1R2B , 1XC5 , 2GPV , 2L5G , 2LTP , 2ODD , 2RT5 , 3R29 , 3R2A , 4A69 , 4OAR , 5X8Q , 5X8X , 5ZOO , 5ZOP , 6A22 , 6IVX , 6PDZ , 7SQA , 8AQM , 8AQN , 8B8W , 8B8X , 8B8Y , 8B8Z , 8B90 , 8B91 , 8B92 , 8B93 , 8B94 , 8B95 , 8X7E

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15784	GPS2_interact	141 → 229	G-protein pathway suppressor 2-interacting domain	Family
PF00249	Myb_DNA-binding	612 → 657	Myb-like DNA-binding domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous (PubMed:10077563). High levels of expression are detected in lung, spleen and brain (PubMed:10077563). {ECO:0000269|PubMed:10077563}.

Sequence

MSGSTQPVAQTWRATEPRYPPHSLSYPVQIARTHTDVGLLEYQHHSRDYASHLSPGSIIQ
PQRRRPSLLSEFQPGNERSQELHLRPESHSYLPELGKSEMEFIESKRPRLELLPDPLLRP
SPLLATGQPAGSEDLTKDRSLTGKLEPVSPPSPPHTDPELELVPPRLSKEELIQNMDRVD
REITMVEQQISKLKKKQQQLEEEAAKPPEPEKPVSPPPIESKHRSLVQIIYDENRKKAEA
AHRILEGLGPQVELPLYNQPSDTRQYHENIKINQAMRKKLILYFKRRNHARKQWEQKFCQ
RYDQLMEAWEKKVERIENNPRRRAKESKVREYYEKQFPEIRKQRELQERMQSRVGQRGSG
LSMSAARSEHEVSEIIDGLSEQENLEKQMRQLAVIPPMLYDADQQRIKFINMNGLMADPM
KVYKDRQVMNMWSEQEKETFREKFMQHPKNFGLIASFLERKTVAECVLYYYLTKKNENYK
SLVRRSYRRRGKSQQQQQQQQQQQQQQQQQPMPRSSQEEKDEKEKEKEAEKEEEKPEVEN
DKEDLLKEKTDDTSGEDNDEKEAVASKGRKTANSQGRRKGRITRSMANEANSEEAITPQQ
SAELASMELNESSRWTEEEMETAKKGLLEHGRNWSAIARMVGSKTVSQCKNFYFNYKKRQ
NLDEILQQHKLKMEKERNARRKKKKAPAAASEEAAFPPVVEDEEMEASGVSGNEEEMVEE
AEALHASGNEVPRGECSGPATVNNSSDTESIPSPHTEAAKDTGQNGPKPPATLGADGPPP
GPPTPPPEDIPAPTEPTPASEATGAPTPPPAPPSPSAPPPVVPKEEKEEETAAAPPVEEG
EEQKPPAAEELAVDTGKAEEPVKSECTEEAEEGPAKGKDAEAAEATAEGALKAEKKEGGS
GRATTAKSSGAPQDSDSSATCSADEVDEAEGGDKNRLLSPRPSLLTPTGDPRANASPQKP
LDLKQLKQRAAAIPPIQVTKVHEPPREDAAPTKPAPPAPPPPQNLQPESDAPQQPGSSPR
GKSRSPAPPADKEAFAAEAQKLPGDPPCWTSGLPFPVPPREVIKASPHAPDPSAFSYAPP
GHPLPLGLHDTARPVLPRPPTISNPPPLISSAKHPSVLERQIGAISQGMSVQLHVPYSEH
AKAPVGPVTMGLPLPMDPKKLAPFSGVKQEQLSPRGQAGPPESLGVPTAQEASVLRGTAL
GSVPGGSITKGIPSTRVPSDSAITYRGSITHGTPADVLYKGTITRIIGEDSPSRLDRGRE
DSLPKGHVIYEGKKGHVLSYEGGMSVTQCSKEDGRSSSGPPHETAAPKRTYDMMEGRVGR
AISSASIEGLMGRAIPPERHSPHHLKEQHHIRGSITQGIPRSYVEAQEDYLRREAKLLKR
EGTPPPPPPSRDLTEAYKTQALGPLKLKPAHEGLVATVKEAGRSIHEIPREELRHTPELP
LAPRPLKEGSITQGTPLKYDTGASTTGSKKHDVRSLIGSPGRTFPPVHPLDVMADARALE
RACYEESLKSRPGTASSSGGSIARGAPVIVPELGKPRQSPLTYEDHGAPFAGHLPRGSPV
TTREPTPRLQEGSLSSSKASQDRKLTSTPREIAKSPHSTVPEHHPHPISPYEHLLRGVSG
VDLYRSHIPLAFDPTSIPRGIPLDAAAAYYLPRHLAPNPTYPHLYPPYLIRGYPDTAALE
NRQTIINDYITSQQMHHNAATAMAQRADMLRGLSPRESSLALNYAAGPRGIIDLSQVPHL
PVLVPPTPGTPATAMDRLAYLPTAPQPFSSRHSSSPLSPGGPTHLTKPTTTSSSERERDR
DRERDRDREREKSILTSTTTVEHAPIWRPGTEQSSGSSGGGGGSSSRPASHSHAHQHSPI
SPRTQDALQQRPSVLHNTGMKGIITAVEPSTPTVLRSTSTSSPVRPAATFPPATHCPLGG
TLDGVYPTLMEPVLLPKEAPRVARPERPRADTGHAFLAKPPARSGLEPASSPSKGSEPRP
LVPPVSGHATIARTPAKNLAPHHASPDPPAPPASASDPHREKTQSKPFSIQELELRSLGY
HGSSYSPEGVEPVSPVSSPSLTHDKGLPKHLEELDKSHLEGELRPKQPGPVKLGGEAAHL
PHLRPLPESQPSSSPLLQTAPGVKGHQRVVTLAQHISEVITQDYTRHHPQQLSAPLPAPL
YSFPGASCPVLDLRRPPSDLYLPPPDHGAPARGSPHSEGGKRSPEPNKTSVLGGGEDGIE
PVSPPEGMTEPGHSRSAVYPLLYRDGEQTEPSRMGSKSPGNTSQPPAFFSKLTESNSAMV
KSKKQEINKKLNTHNRNEPEYNISQPGTEIFNMPAITGTGLMTYRSQAVQEHASTNMGLE
AIIRKALMGKYDQWEESPPLSANAFNPLNASASLPAAMPITAADGRSDHTLTSPGGGGKA
KVSGRPSSRKAKSPAPGLASGDRPPSVSSVHSEGDCNRRTPLTNRVWEDRPSSAGSTPFP
YNPLIMRLQAGVMASPPPPGLPAGSGPLAGPHHAWDEEPKPLLCSQYETLSDSE

Sequence length

2514

Interactions

View interactions

	KEGG		Reactome
	Notch signaling pathway Epstein-Barr virus infection		PPARA activates gene expression Downregulation of SMAD2/3:SMAD4 transcriptional activity Constitutive Signaling by NOTCH1 PEST Domain Mutants Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants HDACs deacetylate histones Notch-HLH transcription pathway Transcriptional regulation of white adipocyte differentiation Nuclear Receptor transcription pathway Regulation of lipid metabolism by PPARalpha NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux HCMV Early Events NR1H2 & NR1H3 regulate gene expression to control bile acid homeostasis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Multiple myeloma	Likely pathogenic	rs1593107841	RCV000984103	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (33)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOEMBOLIC STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALUNION FRACTURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NCOR2-related disorder	Benign; Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (110)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	28225754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	12032336, 9256429, 9765306, 9989813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29764865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	30082871	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	9619899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	12645858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	37802634	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	21143702	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	23652012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	23652012	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	20385356, 27856253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign adult familial myoclonic epilepsy	Benign Myoclonic Epilepsy	BEFREE	30559482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bicuspid Aortic Valve Disease	Bicuspid aortic valve	Pubtator	36071494	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	15635693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Neoplasms	Bone neoplasm	Pubtator	35181586	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10589759, 10690532, 16886664, 19904269, 20003447, 20392877, 23015261, 23117886, 24971610, 25363551, 29023534, 29420220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19183483, 19904269, 20003447, 20392877, 23015261, 24971610, 29023534, 35618935	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	16434963, 30680848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	22887771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	37131060	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	32196466	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carney Complex	Carney Complex	BEFREE	28225754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central hypothyroidism	Central hypothyroidism	BEFREE	29794369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Combined immunodeficiency	Severe combined immunodeficiency disease	GENOMICS_ENGLAND_DG	3464003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital clubfoot	Congenital Clubfoot	BEFREE	24667120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	15334463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	24204704	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	1982251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	21109196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	17545502		★★★★★ ★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	Digeorge syndrome	Pubtator	31830774	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	14601091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	34763648	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	36899621	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	19416222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized Thyroid Hormone Resistance	Thyroid Hormone Resistance	BEFREE	11061510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	Pubtator	35181586	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24244722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32945237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24244722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	20957337, 21143702	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	19470682	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	35748249	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	15930272, 2323775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypereosinophilia	Hypereosinophilia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	10803578		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	19470682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	21083371		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10544023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	15729358	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	9256429, 9765306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	22553924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30680848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	15930272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	15930272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10589759, 10690532, 16886664, 19904269, 20003447, 20392877, 23015261, 23117886, 24971610, 25363551, 29023534, 29420220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16886664, 20466759, 20568894, 21178266, 21720703, 22695118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	20187983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16886664, 29674510, 29764865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10589759, 11916237, 19904269, 20392877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	14715875, 15802375, 17902051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	25953768	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	27468165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	21109196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	19417136		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Multiple Myeloma	Multiple myeloma	Pubtator	34864816	Associate	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Muscular Atrophy Spinal	Spinal muscular atrophy	Pubtator	25821969	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	GWASDB_DG	21211798		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	34371182	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	BEFREE	22177342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10589759, 12682631, 15300237, 16886664, 21901538, 22695118, 28225754, 8631023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10094499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	10094499, 21212796	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	10690532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23221346, 33198820	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	23221346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	19904269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	15334463	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis Knee	Osteoarthritis	Pubtator	16453284	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31973910, 37131060, 37512088	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	29687770	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	29687770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	31089932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
POPLITEAL PTERYGIUM SYNDROME, LETHAL TYPE	Bartsocas-Papas syndrome	BEFREE	31410520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	10361104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	21109196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16886664, 20466759, 20568894, 21178266, 21720703, 22695118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15300237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15300237, 21178266, 35286517	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	35960497	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	12967552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett syndrome	Pubtator	28348241	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	15935573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	9259417, 9336413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seckel syndrome 1	Seckel syndrome	Pubtator	40114033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	21410672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	25821969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27349552, 29470550	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	29470550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	20187983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	20187983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32373223, 35039565	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Prolymphocytic Leukemia	T-Cell Prolymphocytic Leukemia	BEFREE	26493028		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-CELL RECEPTOR-ALPHA/BETA DEFICIENCY	T-Cell Receptor Alpha/Beta Deficiency	ORPHANET_DG	21206088		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-CELL RECEPTOR-ALPHA/BETA DEFICIENCY	T-Cell Receptor Alpha/Beta Deficiency	GENOMICS_ENGLAND_DG	3464003		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-CELL RECEPTOR-ALPHA/BETA DEFICIENCY	T-Cell Receptor Alpha/Beta Deficiency	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
T-CELL RECEPTOR-ALPHA/BETA DEFICIENCY	T-Cell Receptor Alpha/Beta Deficiency	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
TCR-alpha-beta-positive T-cell deficiency	T-Cell Receptor Alpha/Beta Deficiency	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	32940102	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	19416222		★★★★★ ★☆☆☆☆ Found in Text Mining only

NCOR2 (nuclear receptor corepressor 2)