Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	961
Gene name	CD47 molecule
Gene symbol	CD47
Synonyms (NCBI Gene)	IAPMER6OA3
Chromosome	3
Chromosome location	3q13.12
Summary	This gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombo

619

Show/Hide all (619)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030709	hsa-miR-21-5p	Microarray	18591254
MIRT040987	hsa-miR-505-3p	CLASH	23622248
MIRT440977	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT440976	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT440977	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT728026	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT728025	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT728024	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT728023	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT440976	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT735701	hsa-miR-222-3p	Luciferase reporter assayWestern blottingqRT-PCR	31933820
MIRT875653	hsa-miR-1183	CLIP-seq
MIRT875654	hsa-miR-1226	CLIP-seq
MIRT875655	hsa-miR-1229	CLIP-seq
MIRT875656	hsa-miR-1236	CLIP-seq
MIRT875657	hsa-miR-1245	CLIP-seq
MIRT875658	hsa-miR-1254	CLIP-seq
MIRT875659	hsa-miR-1256	CLIP-seq
MIRT875660	hsa-miR-1286	CLIP-seq
MIRT875661	hsa-miR-129-5p	CLIP-seq
MIRT875662	hsa-miR-141	CLIP-seq
MIRT875663	hsa-miR-150	CLIP-seq
MIRT875664	hsa-miR-15a	CLIP-seq
MIRT875665	hsa-miR-15b	CLIP-seq
MIRT875666	hsa-miR-16	CLIP-seq
MIRT875667	hsa-miR-182	CLIP-seq
MIRT875668	hsa-miR-1827	CLIP-seq
MIRT875669	hsa-miR-1912	CLIP-seq
MIRT875670	hsa-miR-195	CLIP-seq
MIRT875671	hsa-miR-200a	CLIP-seq
MIRT875672	hsa-miR-219-1-3p	CLIP-seq
MIRT875673	hsa-miR-221	CLIP-seq
MIRT875674	hsa-miR-222	CLIP-seq
MIRT875675	hsa-miR-2355-3p	CLIP-seq
MIRT875676	hsa-miR-298	CLIP-seq
MIRT875677	hsa-miR-3074-5p	CLIP-seq
MIRT875678	hsa-miR-3116	CLIP-seq
MIRT875679	hsa-miR-3120-3p	CLIP-seq
MIRT875680	hsa-miR-3134	CLIP-seq
MIRT875681	hsa-miR-3137	CLIP-seq
MIRT875682	hsa-miR-3145-5p	CLIP-seq
MIRT875683	hsa-miR-3152-5p	CLIP-seq
MIRT875684	hsa-miR-3166	CLIP-seq
MIRT875685	hsa-miR-3185	CLIP-seq
MIRT875686	hsa-miR-3192	CLIP-seq
MIRT875687	hsa-miR-320a	CLIP-seq
MIRT875688	hsa-miR-320b	CLIP-seq
MIRT875689	hsa-miR-320c	CLIP-seq
MIRT875690	hsa-miR-320d	CLIP-seq
MIRT875691	hsa-miR-326	CLIP-seq
MIRT875692	hsa-miR-330-5p	CLIP-seq
MIRT875693	hsa-miR-361-3p	CLIP-seq
MIRT875694	hsa-miR-3671	CLIP-seq
MIRT875695	hsa-miR-3675-3p	CLIP-seq
MIRT875696	hsa-miR-3679-3p	CLIP-seq
MIRT875697	hsa-miR-3680	CLIP-seq
MIRT875698	hsa-miR-376a	CLIP-seq
MIRT875699	hsa-miR-376b	CLIP-seq
MIRT875700	hsa-miR-383	CLIP-seq
MIRT875701	hsa-miR-3935	CLIP-seq
MIRT875702	hsa-miR-3942-5p	CLIP-seq
MIRT875703	hsa-miR-421	CLIP-seq
MIRT875704	hsa-miR-424	CLIP-seq
MIRT875705	hsa-miR-4252	CLIP-seq
MIRT875706	hsa-miR-4257	CLIP-seq
MIRT875707	hsa-miR-4270	CLIP-seq
MIRT875708	hsa-miR-4286	CLIP-seq
MIRT875709	hsa-miR-4297	CLIP-seq
MIRT875710	hsa-miR-4299	CLIP-seq
MIRT875711	hsa-miR-4301	CLIP-seq
MIRT875712	hsa-miR-4307	CLIP-seq
MIRT875713	hsa-miR-4314	CLIP-seq
MIRT875714	hsa-miR-433	CLIP-seq
MIRT875715	hsa-miR-4429	CLIP-seq
MIRT875716	hsa-miR-4441	CLIP-seq
MIRT875717	hsa-miR-4456	CLIP-seq
MIRT875718	hsa-miR-4469	CLIP-seq
MIRT875719	hsa-miR-4470	CLIP-seq
MIRT875720	hsa-miR-450b-3p	CLIP-seq
MIRT875721	hsa-miR-4524	CLIP-seq
MIRT875722	hsa-miR-4527	CLIP-seq
MIRT875723	hsa-miR-4533	CLIP-seq
MIRT875724	hsa-miR-4534	CLIP-seq
MIRT875725	hsa-miR-455-5p	CLIP-seq
MIRT875726	hsa-miR-4645-5p	CLIP-seq
MIRT875727	hsa-miR-4646-3p	CLIP-seq
MIRT875728	hsa-miR-4646-5p	CLIP-seq
MIRT875729	hsa-miR-4659a-3p	CLIP-seq
MIRT875730	hsa-miR-4659b-3p	CLIP-seq
MIRT875731	hsa-miR-4666-5p	CLIP-seq
MIRT875732	hsa-miR-4673	CLIP-seq
MIRT875733	hsa-miR-4681	CLIP-seq
MIRT875734	hsa-miR-4682	CLIP-seq
MIRT875735	hsa-miR-4698	CLIP-seq
MIRT875736	hsa-miR-4700-3p	CLIP-seq
MIRT875737	hsa-miR-4703-5p	CLIP-seq
MIRT875738	hsa-miR-4709-5p	CLIP-seq
MIRT875739	hsa-miR-4711-5p	CLIP-seq
MIRT875740	hsa-miR-4713-3p	CLIP-seq
MIRT875741	hsa-miR-4715-5p	CLIP-seq
MIRT875742	hsa-miR-4718	CLIP-seq
MIRT875743	hsa-miR-4722-3p	CLIP-seq
MIRT875744	hsa-miR-4733-3p	CLIP-seq
MIRT875745	hsa-miR-4738-3p	CLIP-seq
MIRT875746	hsa-miR-4747-5p	CLIP-seq
MIRT875747	hsa-miR-4759	CLIP-seq
MIRT875748	hsa-miR-4762-5p	CLIP-seq
MIRT875749	hsa-miR-4768-5p	CLIP-seq
MIRT875750	hsa-miR-4772-5p	CLIP-seq
MIRT875751	hsa-miR-4774-3p	CLIP-seq
MIRT875752	hsa-miR-4775	CLIP-seq
MIRT875753	hsa-miR-4786-3p	CLIP-seq
MIRT875754	hsa-miR-4790-3p	CLIP-seq
MIRT875755	hsa-miR-4795-3p	CLIP-seq
MIRT875756	hsa-miR-4795-5p	CLIP-seq
MIRT875757	hsa-miR-486-5p	CLIP-seq
MIRT875758	hsa-miR-492	CLIP-seq
MIRT875759	hsa-miR-497	CLIP-seq
MIRT875760	hsa-miR-503	CLIP-seq
MIRT875761	hsa-miR-505	CLIP-seq
MIRT875762	hsa-miR-508-5p	CLIP-seq
MIRT875763	hsa-miR-548a-3p	CLIP-seq
MIRT875764	hsa-miR-548ad	CLIP-seq
MIRT875765	hsa-miR-548e	CLIP-seq
MIRT875766	hsa-miR-548f	CLIP-seq
MIRT875767	hsa-miR-548n	CLIP-seq
MIRT875768	hsa-miR-548q	CLIP-seq
MIRT875769	hsa-miR-548t	CLIP-seq
MIRT875770	hsa-miR-548v	CLIP-seq
MIRT875771	hsa-miR-550a	CLIP-seq
MIRT875772	hsa-miR-555	CLIP-seq
MIRT875773	hsa-miR-561	CLIP-seq
MIRT875774	hsa-miR-571	CLIP-seq
MIRT875775	hsa-miR-583	CLIP-seq
MIRT875776	hsa-miR-590-3p	CLIP-seq
MIRT875777	hsa-miR-602	CLIP-seq
MIRT875778	hsa-miR-607	CLIP-seq
MIRT875779	hsa-miR-638	CLIP-seq
MIRT875780	hsa-miR-642a	CLIP-seq
MIRT875781	hsa-miR-643	CLIP-seq
MIRT875782	hsa-miR-646	CLIP-seq
MIRT875783	hsa-miR-661	CLIP-seq
MIRT875784	hsa-miR-668	CLIP-seq
MIRT875785	hsa-miR-671-5p	CLIP-seq
MIRT875786	hsa-miR-7	CLIP-seq
MIRT875787	hsa-miR-767-3p	CLIP-seq
MIRT875788	hsa-miR-769-3p	CLIP-seq
MIRT875789	hsa-miR-922	CLIP-seq
MIRT875790	hsa-miR-940	CLIP-seq
MIRT875791	hsa-miR-942	CLIP-seq
MIRT1959604	hsa-miR-1205	CLIP-seq
MIRT1959605	hsa-miR-1252	CLIP-seq
MIRT1959606	hsa-miR-1257	CLIP-seq
MIRT1959607	hsa-miR-1273f	CLIP-seq
MIRT1959608	hsa-miR-1276	CLIP-seq
MIRT875660	hsa-miR-1286	CLIP-seq
MIRT875661	hsa-miR-129-5p	CLIP-seq
MIRT1959609	hsa-miR-1305	CLIP-seq
MIRT1959610	hsa-miR-143	CLIP-seq
MIRT875667	hsa-miR-182	CLIP-seq
MIRT1959611	hsa-miR-18a	CLIP-seq
MIRT1959612	hsa-miR-18b	CLIP-seq
MIRT1959613	hsa-miR-214	CLIP-seq
MIRT1959614	hsa-miR-3125	CLIP-seq
MIRT875680	hsa-miR-3134	CLIP-seq
MIRT1959615	hsa-miR-3150b-3p	CLIP-seq
MIRT875683	hsa-miR-3152-5p	CLIP-seq
MIRT1959616	hsa-miR-3154	CLIP-seq
MIRT875687	hsa-miR-320a	CLIP-seq
MIRT875688	hsa-miR-320b	CLIP-seq
MIRT875689	hsa-miR-320c	CLIP-seq
MIRT875690	hsa-miR-320d	CLIP-seq
MIRT1959617	hsa-miR-3619-5p	CLIP-seq
MIRT1959618	hsa-miR-365	CLIP-seq
MIRT875694	hsa-miR-3671	CLIP-seq
MIRT1959619	hsa-miR-3688-5p	CLIP-seq
MIRT1959620	hsa-miR-3916	CLIP-seq
MIRT1959621	hsa-miR-3936	CLIP-seq
MIRT875706	hsa-miR-4257	CLIP-seq
MIRT1959622	hsa-miR-4274	CLIP-seq
MIRT875709	hsa-miR-4297	CLIP-seq
MIRT875715	hsa-miR-4429	CLIP-seq
MIRT1959623	hsa-miR-4464	CLIP-seq
MIRT1959624	hsa-miR-4468	CLIP-seq
MIRT875719	hsa-miR-4470	CLIP-seq
MIRT1959625	hsa-miR-4495	CLIP-seq
MIRT1959626	hsa-miR-4501	CLIP-seq
MIRT1959627	hsa-miR-4504	CLIP-seq
MIRT1959628	hsa-miR-4517	CLIP-seq
MIRT1959629	hsa-miR-4520b-3p	CLIP-seq
MIRT1959630	hsa-miR-4529-3p	CLIP-seq
MIRT875724	hsa-miR-4534	CLIP-seq
MIRT875729	hsa-miR-4659a-3p	CLIP-seq
MIRT1959631	hsa-miR-4659a-5p	CLIP-seq
MIRT875730	hsa-miR-4659b-3p	CLIP-seq
MIRT1959632	hsa-miR-4659b-5p	CLIP-seq
MIRT875735	hsa-miR-4698	CLIP-seq
MIRT1959633	hsa-miR-4699-3p	CLIP-seq
MIRT1959634	hsa-miR-4710	CLIP-seq
MIRT1959635	hsa-miR-4722-5p	CLIP-seq
MIRT1959636	hsa-miR-4735-3p	CLIP-seq
MIRT1959637	hsa-miR-4748	CLIP-seq
MIRT875748	hsa-miR-4762-5p	CLIP-seq
MIRT1959638	hsa-miR-4769-3p	CLIP-seq
MIRT1959639	hsa-miR-4770	CLIP-seq
MIRT875751	hsa-miR-4774-3p	CLIP-seq
MIRT1959640	hsa-miR-4776-3p	CLIP-seq
MIRT1959641	hsa-miR-4784	CLIP-seq
MIRT875754	hsa-miR-4790-3p	CLIP-seq
MIRT1959642	hsa-miR-4792	CLIP-seq
MIRT875755	hsa-miR-4795-3p	CLIP-seq
MIRT1959643	hsa-miR-4802-5p	CLIP-seq
MIRT1959644	hsa-miR-498	CLIP-seq
MIRT1959645	hsa-miR-5095	CLIP-seq
MIRT1959646	hsa-miR-513a-3p	CLIP-seq
MIRT1959647	hsa-miR-520d-5p	CLIP-seq
MIRT1959648	hsa-miR-524-5p	CLIP-seq
MIRT1959649	hsa-miR-548ae	CLIP-seq
MIRT1959650	hsa-miR-548aj	CLIP-seq
MIRT1959651	hsa-miR-548am	CLIP-seq
MIRT1959652	hsa-miR-548g	CLIP-seq
MIRT875767	hsa-miR-548n	CLIP-seq
MIRT1959653	hsa-miR-548p	CLIP-seq
MIRT875769	hsa-miR-548t	CLIP-seq
MIRT1959654	hsa-miR-548x	CLIP-seq
MIRT1959655	hsa-miR-549	CLIP-seq
MIRT875773	hsa-miR-561	CLIP-seq
MIRT875774	hsa-miR-571	CLIP-seq
MIRT1959656	hsa-miR-578	CLIP-seq
MIRT875775	hsa-miR-583	CLIP-seq
MIRT875776	hsa-miR-590-3p	CLIP-seq
MIRT875778	hsa-miR-607	CLIP-seq
MIRT1959657	hsa-miR-761	CLIP-seq
MIRT1959658	hsa-miR-765	CLIP-seq
MIRT1959659	hsa-miR-935	CLIP-seq
MIRT875791	hsa-miR-942	CLIP-seq
MIRT875654	hsa-miR-1226	CLIP-seq
MIRT875655	hsa-miR-1229	CLIP-seq
MIRT2196506	hsa-miR-1244	CLIP-seq
MIRT2196507	hsa-miR-1245b-3p	CLIP-seq
MIRT875659	hsa-miR-1256	CLIP-seq
MIRT1959606	hsa-miR-1257	CLIP-seq
MIRT1959608	hsa-miR-1276	CLIP-seq
MIRT2196508	hsa-miR-128	CLIP-seq
MIRT2196509	hsa-miR-1289	CLIP-seq
MIRT875661	hsa-miR-129-5p	CLIP-seq
MIRT2196510	hsa-miR-300	CLIP-seq
MIRT1959614	hsa-miR-3125	CLIP-seq
MIRT2196511	hsa-miR-3129-3p	CLIP-seq
MIRT875680	hsa-miR-3134	CLIP-seq
MIRT875682	hsa-miR-3145-5p	CLIP-seq
MIRT2196512	hsa-miR-3202	CLIP-seq
MIRT875687	hsa-miR-320a	CLIP-seq
MIRT875688	hsa-miR-320b	CLIP-seq
MIRT875689	hsa-miR-320c	CLIP-seq
MIRT875690	hsa-miR-320d	CLIP-seq
MIRT875691	hsa-miR-326	CLIP-seq
MIRT875692	hsa-miR-330-5p	CLIP-seq
MIRT2196513	hsa-miR-34a	CLIP-seq
MIRT2196514	hsa-miR-34c-5p	CLIP-seq
MIRT2196515	hsa-miR-3610	CLIP-seq
MIRT2196516	hsa-miR-3620	CLIP-seq
MIRT875694	hsa-miR-3671	CLIP-seq
MIRT875695	hsa-miR-3675-3p	CLIP-seq
MIRT2196517	hsa-miR-381	CLIP-seq
MIRT2196518	hsa-miR-3907	CLIP-seq
MIRT1959620	hsa-miR-3916	CLIP-seq
MIRT2196519	hsa-miR-3922-5p	CLIP-seq
MIRT875703	hsa-miR-421	CLIP-seq
MIRT875706	hsa-miR-4257	CLIP-seq
MIRT875714	hsa-miR-433	CLIP-seq
MIRT2196520	hsa-miR-4428	CLIP-seq
MIRT875715	hsa-miR-4429	CLIP-seq
MIRT2196521	hsa-miR-4436b-3p	CLIP-seq
MIRT1959623	hsa-miR-4464	CLIP-seq
MIRT2196522	hsa-miR-4476	CLIP-seq
MIRT2196523	hsa-miR-4477a	CLIP-seq
MIRT2196524	hsa-miR-4496	CLIP-seq
MIRT2196525	hsa-miR-449a	CLIP-seq
MIRT2196526	hsa-miR-449b	CLIP-seq
MIRT875724	hsa-miR-4534	CLIP-seq
MIRT875726	hsa-miR-4645-5p	CLIP-seq
MIRT875729	hsa-miR-4659a-3p	CLIP-seq
MIRT875730	hsa-miR-4659b-3p	CLIP-seq
MIRT2196527	hsa-miR-4672	CLIP-seq
MIRT875732	hsa-miR-4673	CLIP-seq
MIRT875734	hsa-miR-4682	CLIP-seq
MIRT2196528	hsa-miR-4683	CLIP-seq
MIRT2196529	hsa-miR-4705	CLIP-seq
MIRT2196530	hsa-miR-4709-3p	CLIP-seq
MIRT875738	hsa-miR-4709-5p	CLIP-seq
MIRT2196531	hsa-miR-4713-5p	CLIP-seq
MIRT2196532	hsa-miR-4716-5p	CLIP-seq
MIRT2196533	hsa-miR-4720-3p	CLIP-seq
MIRT2196534	hsa-miR-4731-3p	CLIP-seq
MIRT875744	hsa-miR-4733-3p	CLIP-seq
MIRT875745	hsa-miR-4738-3p	CLIP-seq
MIRT1959637	hsa-miR-4748	CLIP-seq
MIRT2196535	hsa-miR-4753-5p	CLIP-seq
MIRT2196536	hsa-miR-4761-3p	CLIP-seq
MIRT875748	hsa-miR-4762-5p	CLIP-seq
MIRT875752	hsa-miR-4775	CLIP-seq
MIRT875754	hsa-miR-4790-3p	CLIP-seq
MIRT875755	hsa-miR-4795-3p	CLIP-seq
MIRT2196537	hsa-miR-4801	CLIP-seq
MIRT2196538	hsa-miR-4804-3p	CLIP-seq
MIRT2196539	hsa-miR-485-3p	CLIP-seq
MIRT2196540	hsa-miR-487a	CLIP-seq
MIRT875761	hsa-miR-505	CLIP-seq
MIRT875762	hsa-miR-508-5p	CLIP-seq
MIRT2196541	hsa-miR-515-5p	CLIP-seq
MIRT1959647	hsa-miR-520d-5p	CLIP-seq
MIRT1959648	hsa-miR-524-5p	CLIP-seq
MIRT875767	hsa-miR-548n	CLIP-seq
MIRT875769	hsa-miR-548t	CLIP-seq
MIRT2196542	hsa-miR-550b	CLIP-seq
MIRT2196543	hsa-miR-562	CLIP-seq
MIRT1959656	hsa-miR-578	CLIP-seq
MIRT875775	hsa-miR-583	CLIP-seq
MIRT875776	hsa-miR-590-3p	CLIP-seq
MIRT2196544	hsa-miR-591	CLIP-seq
MIRT2196545	hsa-miR-595	CLIP-seq
MIRT2196546	hsa-miR-597	CLIP-seq
MIRT875778	hsa-miR-607	CLIP-seq
MIRT2196547	hsa-miR-628-5p	CLIP-seq
MIRT2196548	hsa-miR-630	CLIP-seq
MIRT875782	hsa-miR-646	CLIP-seq
MIRT875784	hsa-miR-668	CLIP-seq
MIRT875785	hsa-miR-671-5p	CLIP-seq
MIRT875786	hsa-miR-7	CLIP-seq
MIRT875789	hsa-miR-922	CLIP-seq
MIRT875790	hsa-miR-940	CLIP-seq
MIRT875791	hsa-miR-942	CLIP-seq
MIRT2196549	hsa-miR-944	CLIP-seq
MIRT1959608	hsa-miR-1276	CLIP-seq
MIRT2385747	hsa-miR-4311	CLIP-seq
MIRT1959623	hsa-miR-4464	CLIP-seq
MIRT1959631	hsa-miR-4659a-5p	CLIP-seq
MIRT1959632	hsa-miR-4659b-5p	CLIP-seq
MIRT1959635	hsa-miR-4722-5p	CLIP-seq
MIRT1959637	hsa-miR-4748	CLIP-seq
MIRT1959640	hsa-miR-4776-3p	CLIP-seq
MIRT875775	hsa-miR-583	CLIP-seq
MIRT2446601	hsa-miR-3123	CLIP-seq
MIRT2446602	hsa-miR-425	CLIP-seq
MIRT2446603	hsa-miR-4281	CLIP-seq
MIRT1959628	hsa-miR-4517	CLIP-seq
MIRT2499648	hsa-miR-1228	CLIP-seq
MIRT875656	hsa-miR-1236	CLIP-seq
MIRT875658	hsa-miR-1254	CLIP-seq
MIRT2499649	hsa-miR-125a-3p	CLIP-seq
MIRT1959607	hsa-miR-1273f	CLIP-seq
MIRT875660	hsa-miR-1286	CLIP-seq
MIRT2499650	hsa-miR-1303	CLIP-seq
MIRT2499651	hsa-miR-130a	CLIP-seq
MIRT2499652	hsa-miR-130b	CLIP-seq
MIRT2499653	hsa-miR-135a	CLIP-seq
MIRT2499654	hsa-miR-135b	CLIP-seq
MIRT2499655	hsa-miR-140-3p	CLIP-seq
MIRT875662	hsa-miR-141	CLIP-seq
MIRT1959610	hsa-miR-143	CLIP-seq
MIRT2499656	hsa-miR-145	CLIP-seq
MIRT2499657	hsa-miR-188-5p	CLIP-seq
MIRT2499658	hsa-miR-192	CLIP-seq
MIRT2499659	hsa-miR-19a	CLIP-seq
MIRT2499660	hsa-miR-19b	CLIP-seq
MIRT875671	hsa-miR-200a	CLIP-seq
MIRT2499661	hsa-miR-2052	CLIP-seq
MIRT2499662	hsa-miR-2117	CLIP-seq
MIRT1959613	hsa-miR-214	CLIP-seq
MIRT2499663	hsa-miR-215	CLIP-seq
MIRT2499664	hsa-miR-2278	CLIP-seq
MIRT2499665	hsa-miR-299-3p	CLIP-seq
MIRT2499666	hsa-miR-301a	CLIP-seq
MIRT2499667	hsa-miR-301b	CLIP-seq
MIRT2499668	hsa-miR-302f	CLIP-seq
MIRT2499669	hsa-miR-3065-5p	CLIP-seq
MIRT875678	hsa-miR-3116	CLIP-seq
MIRT2499670	hsa-miR-3119	CLIP-seq
MIRT2499671	hsa-miR-3140-3p	CLIP-seq
MIRT2499672	hsa-miR-3145-3p	CLIP-seq
MIRT2499673	hsa-miR-3162-5p	CLIP-seq
MIRT2499674	hsa-miR-3163	CLIP-seq
MIRT2499675	hsa-miR-3173-3p	CLIP-seq
MIRT2499676	hsa-miR-3180-5p	CLIP-seq
MIRT875685	hsa-miR-3185	CLIP-seq
MIRT2499677	hsa-miR-3189-5p	CLIP-seq
MIRT875687	hsa-miR-320a	CLIP-seq
MIRT875688	hsa-miR-320b	CLIP-seq
MIRT875689	hsa-miR-320c	CLIP-seq
MIRT875690	hsa-miR-320d	CLIP-seq
MIRT2499678	hsa-miR-323-5p	CLIP-seq
MIRT2499679	hsa-miR-330-3p	CLIP-seq
MIRT2499680	hsa-miR-338-5p	CLIP-seq
MIRT2499681	hsa-miR-340	CLIP-seq
MIRT2196513	hsa-miR-34a	CLIP-seq
MIRT2499682	hsa-miR-34b	CLIP-seq
MIRT2196514	hsa-miR-34c-5p	CLIP-seq
MIRT2499683	hsa-miR-3607-5p	CLIP-seq
MIRT1959617	hsa-miR-3619-5p	CLIP-seq
MIRT2499684	hsa-miR-3647-3p	CLIP-seq
MIRT1959618	hsa-miR-365	CLIP-seq
MIRT2499685	hsa-miR-3661	CLIP-seq
MIRT2499686	hsa-miR-3662	CLIP-seq
MIRT2499687	hsa-miR-3665	CLIP-seq
MIRT2499688	hsa-miR-3666	CLIP-seq
MIRT875694	hsa-miR-3671	CLIP-seq
MIRT2499689	hsa-miR-3676	CLIP-seq
MIRT875697	hsa-miR-3680	CLIP-seq
MIRT2499690	hsa-miR-3714	CLIP-seq
MIRT875700	hsa-miR-383	CLIP-seq
MIRT2499691	hsa-miR-3925-3p	CLIP-seq
MIRT2499692	hsa-miR-3973	CLIP-seq
MIRT2446602	hsa-miR-425	CLIP-seq
MIRT2499693	hsa-miR-4254	CLIP-seq
MIRT2499694	hsa-miR-4295	CLIP-seq
MIRT2499695	hsa-miR-4423-5p	CLIP-seq
MIRT2196520	hsa-miR-4428	CLIP-seq
MIRT875715	hsa-miR-4429	CLIP-seq
MIRT2499696	hsa-miR-4473	CLIP-seq
MIRT2499697	hsa-miR-4477b	CLIP-seq
MIRT2499698	hsa-miR-4484	CLIP-seq
MIRT2196525	hsa-miR-449a	CLIP-seq
MIRT2196526	hsa-miR-449b	CLIP-seq
MIRT2499699	hsa-miR-4509	CLIP-seq
MIRT875720	hsa-miR-450b-3p	CLIP-seq
MIRT1959628	hsa-miR-4517	CLIP-seq
MIRT2499700	hsa-miR-452	CLIP-seq
MIRT2499701	hsa-miR-4530	CLIP-seq
MIRT875724	hsa-miR-4534	CLIP-seq
MIRT2499702	hsa-miR-4535	CLIP-seq
MIRT2499703	hsa-miR-454	CLIP-seq
MIRT2499704	hsa-miR-4648	CLIP-seq
MIRT2499705	hsa-miR-4653-3p	CLIP-seq
MIRT2499706	hsa-miR-4654	CLIP-seq
MIRT1959631	hsa-miR-4659a-5p	CLIP-seq
MIRT1959632	hsa-miR-4659b-5p	CLIP-seq
MIRT2499707	hsa-miR-4666-3p	CLIP-seq
MIRT2499708	hsa-miR-4668-3p	CLIP-seq
MIRT2499709	hsa-miR-4671-3p	CLIP-seq
MIRT2499710	hsa-miR-4676-3p	CLIP-seq
MIRT875740	hsa-miR-4713-3p	CLIP-seq
MIRT1959635	hsa-miR-4722-5p	CLIP-seq
MIRT2196534	hsa-miR-4731-3p	CLIP-seq
MIRT2499711	hsa-miR-4735-5p	CLIP-seq
MIRT2499712	hsa-miR-4753-3p	CLIP-seq
MIRT2499713	hsa-miR-4758-3p	CLIP-seq
MIRT2499714	hsa-miR-4768-3p	CLIP-seq
MIRT1959638	hsa-miR-4769-3p	CLIP-seq
MIRT2499715	hsa-miR-4769-5p	CLIP-seq
MIRT1959639	hsa-miR-4770	CLIP-seq
MIRT875752	hsa-miR-4775	CLIP-seq
MIRT1959640	hsa-miR-4776-3p	CLIP-seq
MIRT875754	hsa-miR-4790-3p	CLIP-seq
MIRT2196537	hsa-miR-4801	CLIP-seq
MIRT1959643	hsa-miR-4802-5p	CLIP-seq
MIRT875758	hsa-miR-492	CLIP-seq
MIRT2499716	hsa-miR-493	CLIP-seq
MIRT2499717	hsa-miR-495	CLIP-seq
MIRT1959646	hsa-miR-513a-3p	CLIP-seq
MIRT2499718	hsa-miR-513c	CLIP-seq
MIRT2499719	hsa-miR-514b-5p	CLIP-seq
MIRT2196541	hsa-miR-515-5p	CLIP-seq
MIRT2499720	hsa-miR-520g	CLIP-seq
MIRT2499721	hsa-miR-520h	CLIP-seq
MIRT875763	hsa-miR-548a-3p	CLIP-seq
MIRT1959649	hsa-miR-548ae	CLIP-seq
MIRT1959650	hsa-miR-548aj	CLIP-seq
MIRT1959651	hsa-miR-548am	CLIP-seq
MIRT2499722	hsa-miR-548an	CLIP-seq
MIRT2499723	hsa-miR-548c-3p	CLIP-seq
MIRT875765	hsa-miR-548e	CLIP-seq
MIRT875766	hsa-miR-548f	CLIP-seq
MIRT1959652	hsa-miR-548g	CLIP-seq
MIRT1959654	hsa-miR-548x	CLIP-seq
MIRT2499724	hsa-miR-553	CLIP-seq
MIRT2499725	hsa-miR-587	CLIP-seq
MIRT875776	hsa-miR-590-3p	CLIP-seq
MIRT2499726	hsa-miR-605	CLIP-seq
MIRT875778	hsa-miR-607	CLIP-seq
MIRT2499727	hsa-miR-619	CLIP-seq
MIRT2499728	hsa-miR-631	CLIP-seq
MIRT2499729	hsa-miR-633	CLIP-seq
MIRT875779	hsa-miR-638	CLIP-seq
MIRT2499730	hsa-miR-642b	CLIP-seq
MIRT875783	hsa-miR-661	CLIP-seq
MIRT2499731	hsa-miR-665	CLIP-seq
MIRT875784	hsa-miR-668	CLIP-seq
MIRT1959657	hsa-miR-761	CLIP-seq
MIRT1959658	hsa-miR-765	CLIP-seq
MIRT2499732	hsa-miR-766	CLIP-seq
MIRT875787	hsa-miR-767-3p	CLIP-seq
MIRT875788	hsa-miR-769-3p	CLIP-seq
MIRT2499733	hsa-miR-876-3p	CLIP-seq
MIRT2499648	hsa-miR-1228	CLIP-seq
MIRT875656	hsa-miR-1236	CLIP-seq
MIRT875658	hsa-miR-1254	CLIP-seq
MIRT2499649	hsa-miR-125a-3p	CLIP-seq
MIRT1959607	hsa-miR-1273f	CLIP-seq
MIRT875660	hsa-miR-1286	CLIP-seq
MIRT2499651	hsa-miR-130a	CLIP-seq
MIRT2499652	hsa-miR-130b	CLIP-seq
MIRT2499655	hsa-miR-140-3p	CLIP-seq
MIRT875662	hsa-miR-141	CLIP-seq
MIRT1959610	hsa-miR-143	CLIP-seq
MIRT2499656	hsa-miR-145	CLIP-seq
MIRT2499657	hsa-miR-188-5p	CLIP-seq
MIRT2499658	hsa-miR-192	CLIP-seq
MIRT2499659	hsa-miR-19a	CLIP-seq
MIRT2499660	hsa-miR-19b	CLIP-seq
MIRT875671	hsa-miR-200a	CLIP-seq
MIRT2499661	hsa-miR-2052	CLIP-seq
MIRT2499662	hsa-miR-2117	CLIP-seq
MIRT1959613	hsa-miR-214	CLIP-seq
MIRT2499663	hsa-miR-215	CLIP-seq
MIRT2499665	hsa-miR-299-3p	CLIP-seq
MIRT2499666	hsa-miR-301a	CLIP-seq
MIRT2499667	hsa-miR-301b	CLIP-seq
MIRT2499668	hsa-miR-302f	CLIP-seq
MIRT2499669	hsa-miR-3065-5p	CLIP-seq
MIRT875678	hsa-miR-3116	CLIP-seq
MIRT2499672	hsa-miR-3145-3p	CLIP-seq
MIRT2499673	hsa-miR-3162-5p	CLIP-seq
MIRT2499674	hsa-miR-3163	CLIP-seq
MIRT2499675	hsa-miR-3173-3p	CLIP-seq
MIRT2499676	hsa-miR-3180-5p	CLIP-seq
MIRT2499678	hsa-miR-323-5p	CLIP-seq
MIRT2499679	hsa-miR-330-3p	CLIP-seq
MIRT2499680	hsa-miR-338-5p	CLIP-seq
MIRT2499681	hsa-miR-340	CLIP-seq
MIRT2196513	hsa-miR-34a	CLIP-seq
MIRT2499682	hsa-miR-34b	CLIP-seq
MIRT2196514	hsa-miR-34c-5p	CLIP-seq
MIRT1959617	hsa-miR-3619-5p	CLIP-seq
MIRT2499684	hsa-miR-3647-3p	CLIP-seq
MIRT2499685	hsa-miR-3661	CLIP-seq
MIRT2499686	hsa-miR-3662	CLIP-seq
MIRT2499687	hsa-miR-3665	CLIP-seq
MIRT2499688	hsa-miR-3666	CLIP-seq
MIRT2499689	hsa-miR-3676	CLIP-seq
MIRT875697	hsa-miR-3680	CLIP-seq
MIRT2499690	hsa-miR-3714	CLIP-seq
MIRT2499691	hsa-miR-3925-3p	CLIP-seq
MIRT2499692	hsa-miR-3973	CLIP-seq
MIRT2446602	hsa-miR-425	CLIP-seq
MIRT2499693	hsa-miR-4254	CLIP-seq
MIRT2499694	hsa-miR-4295	CLIP-seq
MIRT2499695	hsa-miR-4423-5p	CLIP-seq
MIRT2196520	hsa-miR-4428	CLIP-seq
MIRT2499696	hsa-miR-4473	CLIP-seq
MIRT2499697	hsa-miR-4477b	CLIP-seq
MIRT2499698	hsa-miR-4484	CLIP-seq
MIRT2196525	hsa-miR-449a	CLIP-seq
MIRT2196526	hsa-miR-449b	CLIP-seq
MIRT2499699	hsa-miR-4509	CLIP-seq
MIRT875720	hsa-miR-450b-3p	CLIP-seq
MIRT1959628	hsa-miR-4517	CLIP-seq
MIRT2499700	hsa-miR-452	CLIP-seq
MIRT2499701	hsa-miR-4530	CLIP-seq
MIRT875724	hsa-miR-4534	CLIP-seq
MIRT2499702	hsa-miR-4535	CLIP-seq
MIRT2499703	hsa-miR-454	CLIP-seq
MIRT2499704	hsa-miR-4648	CLIP-seq
MIRT2499705	hsa-miR-4653-3p	CLIP-seq
MIRT2499706	hsa-miR-4654	CLIP-seq
MIRT1959631	hsa-miR-4659a-5p	CLIP-seq
MIRT1959632	hsa-miR-4659b-5p	CLIP-seq
MIRT2499707	hsa-miR-4666-3p	CLIP-seq
MIRT2499708	hsa-miR-4668-3p	CLIP-seq
MIRT2499709	hsa-miR-4671-3p	CLIP-seq
MIRT2499710	hsa-miR-4676-3p	CLIP-seq
MIRT875740	hsa-miR-4713-3p	CLIP-seq
MIRT1959635	hsa-miR-4722-5p	CLIP-seq
MIRT2196534	hsa-miR-4731-3p	CLIP-seq
MIRT2499711	hsa-miR-4735-5p	CLIP-seq
MIRT2499712	hsa-miR-4753-3p	CLIP-seq
MIRT2499714	hsa-miR-4768-3p	CLIP-seq
MIRT2499715	hsa-miR-4769-5p	CLIP-seq
MIRT1959639	hsa-miR-4770	CLIP-seq
MIRT875752	hsa-miR-4775	CLIP-seq
MIRT1959640	hsa-miR-4776-3p	CLIP-seq
MIRT875754	hsa-miR-4790-3p	CLIP-seq
MIRT2196537	hsa-miR-4801	CLIP-seq
MIRT1959643	hsa-miR-4802-5p	CLIP-seq
MIRT875758	hsa-miR-492	CLIP-seq
MIRT2499717	hsa-miR-495	CLIP-seq
MIRT2499718	hsa-miR-513c	CLIP-seq
MIRT2499719	hsa-miR-514b-5p	CLIP-seq
MIRT2196541	hsa-miR-515-5p	CLIP-seq
MIRT2499720	hsa-miR-520g	CLIP-seq
MIRT2499721	hsa-miR-520h	CLIP-seq
MIRT875763	hsa-miR-548a-3p	CLIP-seq
MIRT1959649	hsa-miR-548ae	CLIP-seq
MIRT1959650	hsa-miR-548aj	CLIP-seq
MIRT1959651	hsa-miR-548am	CLIP-seq
MIRT2499722	hsa-miR-548an	CLIP-seq
MIRT2499723	hsa-miR-548c-3p	CLIP-seq
MIRT875765	hsa-miR-548e	CLIP-seq
MIRT875766	hsa-miR-548f	CLIP-seq
MIRT1959652	hsa-miR-548g	CLIP-seq
MIRT1959654	hsa-miR-548x	CLIP-seq
MIRT2499724	hsa-miR-553	CLIP-seq
MIRT2499725	hsa-miR-587	CLIP-seq
MIRT875776	hsa-miR-590-3p	CLIP-seq
MIRT2499726	hsa-miR-605	CLIP-seq
MIRT2499727	hsa-miR-619	CLIP-seq
MIRT2499728	hsa-miR-631	CLIP-seq
MIRT2499729	hsa-miR-633	CLIP-seq
MIRT875779	hsa-miR-638	CLIP-seq
MIRT2499730	hsa-miR-642b	CLIP-seq
MIRT875783	hsa-miR-661	CLIP-seq
MIRT2499731	hsa-miR-665	CLIP-seq
MIRT875784	hsa-miR-668	CLIP-seq
MIRT1959657	hsa-miR-761	CLIP-seq
MIRT1959658	hsa-miR-765	CLIP-seq
MIRT2499732	hsa-miR-766	CLIP-seq
MIRT875787	hsa-miR-767-3p	CLIP-seq
MIRT875788	hsa-miR-769-3p	CLIP-seq
MIRT2499733	hsa-miR-876-3p	CLIP-seq

Show/Hide all (50)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0002684	Process	Positive regulation of immune system process	IEA
GO:0005515	Function	Protein binding	IPI	8550562, 15383453, 15917238, 17070842, 19004835, 24026300, 25416956, 32296183, 32814053, 33961781
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	7998989, 10429193
GO:0006915	Process	Apoptotic process	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	TAS	8294396
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	15383453
GO:0009986	Component	Cell surface	IDA	11509594
GO:0009986	Component	Cell surface	ISS
GO:0009986	Component	Cell surface	NAS	25795378
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	ISS
GO:0022409	Process	Positive regulation of cell-cell adhesion	IBA
GO:0022409	Process	Positive regulation of cell-cell adhesion	IDA	15383453
GO:0022409	Process	Positive regulation of cell-cell adhesion	IEA
GO:0032649	Process	Regulation of type II interferon production	IMP	11509594
GO:0032653	Process	Regulation of interleukin-10 production	IMP	11509594
GO:0032655	Process	Regulation of interleukin-12 production	IMP	11509594
GO:0032675	Process	Regulation of interleukin-6 production	IMP	11509594
GO:0032680	Process	Regulation of tumor necrosis factor production	IMP	11509594
GO:0034113	Process	Heterotypic cell-cell adhesion	IEA
GO:0035579	Component	Specific granule membrane	TAS
GO:0045428	Process	Regulation of nitric oxide biosynthetic process	ISS
GO:0050729	Process	Positive regulation of inflammatory response	IBA
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0050765	Process	Negative regulation of phagocytosis	ISS
GO:0050766	Process	Positive regulation of phagocytosis	IBA
GO:0050766	Process	Positive regulation of phagocytosis	IEA
GO:0050870	Process	Positive regulation of T cell activation	IDA	15383453
GO:0051496	Process	Positive regulation of stress fiber assembly	ISS
GO:0060368	Process	Regulation of Fc receptor mediated stimulatory signaling pathway	ISS	21401967
GO:0070051	Function	Fibrinogen binding	IDA	22079249
GO:0070053	Function	Thrombospondin receptor activity	IBA
GO:0070053	Function	Thrombospondin receptor activity	IDA	8550562
GO:0070053	Function	Thrombospondin receptor activity	IEA
GO:0070053	Function	Thrombospondin receptor activity	IPI	15700281
GO:0070062	Component	Extracellular exosome	IBA
GO:0070821	Component	Tertiary granule membrane	TAS
GO:0071346	Process	Cellular response to type II interferon	ISS
GO:0071347	Process	Cellular response to interleukin-1	ISS
GO:0071349	Process	Cellular response to interleukin-12	IMP	11509594
GO:0086080	Function	Protein binding involved in heterotypic cell-cell adhesion	ISS
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0098632	Function	Cell-cell adhesion mediator activity	IPI	11509594
GO:1904669	Process	ATP export	IDA	24022490
GO:2000439	Process	Positive regulation of monocyte extravasation	ISS

MIM	HGNC	e!Ensembl
601028	1682	ENSG00000196776

Q08722

Protein name

Leukocyte surface antigen CD47 (Antigenic surface determinant protein OA3) (Integrin-associated protein) (IAP) (Protein MER6) (CD antigen CD47)

Protein function

Adhesive protein that mediates cell-to-cell interactions (PubMed:11509594, PubMed:15383453). Acts as a receptor for thrombospondin THBS1 and as modulator of integrin signaling through the activation of heterotrimeric G proteins (PubMed:19004835,

PDB

2JJS , 2JJT , 2VSC , 4CMM , 4KJY , 5IWL , 5TZ2 , 5TZT , 5TZU , 7MYZ , 7WN8 , 7XJF , 7YGG , 8RP8

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08204	V-set_CD47	8 → 142	CD47 immunoglobulin-like domain	Domain
PF04549	CD47	144 → 292	CD47 transmembrane region	Family

Tissue specificity

TISSUE SPECIFICITY: Very broadly distributed on normal adult tissues, as well as ovarian tumors, being especially abundant in some epithelia and the brain. Macrophages (PubMed:39121194). {ECO:0000269|PubMed:39121194}.

Sequence

MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKF
KGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELT
REGETIIELKYRVVSWFSPNENILIVIFPIFAILLFWGQFGIKTLKYRSGGMDEKTIALL
VAGLVITVIVIVGAILFVPGEYSLKNATGLGLIVTSTGILILLHYYVFSTAIGLTSFVIA
ILVIQVIAYILAVVGLSLCIAACIPMHGPLLISGLSILALAQLLGLVYMKFVASNQKTIQ
PPRKAVEEPLNAFKESKGMMNDE

Sequence length

323

Interactions

View interactions

	KEGG		Reactome
	Efferocytosis ECM-receptor interaction		Cell surface interactions at the vascular wall Integrin cell surface interactions Signal regulatory protein family interactions Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (256)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	26944210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	31183877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	15784731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	28398662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	20299817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	26944210		★★★★★ ★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	BEFREE	12153481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	28100392, 29743205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	37063864	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Dyserythropoietic Congenital	Congenital dyserythropoietic anemia	Pubtator	27784127	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Iron Deficiency	Iron deficiency anemia	Pubtator	36734715	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	11264185, 18322255	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Hemolytic	Anemia	BEFREE	10856220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	30892078		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28161480, 29288236, 31771616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	31429376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	11264185	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30755588, 30929259, 31222041, 31337788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	26355501	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	21125662, 25550546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30755588, 30929259, 31222041, 31337788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	36456996	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	LHGDN	15359629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	16564725, 21151203, 24091004, 25305319, 27578867, 28208074		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	38111586	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune hemolytic anemia	Autoimmune hemolytic anemia	LHGDN	15359629, 18954403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune hemolytic anemia	Autoimmune hemolytic anemia	BEFREE	16564725, 17163870, 18954403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	BEFREE	18177647		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29743205, 30226089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	CTD_human_DG	31043756		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	GWASCAT_DG	31043756		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	19666525, 20119625, 25355698, 27206428, 28139689, 28186432, 28839158, 30890547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	19661269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	28298418, 30898840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20705613, 22451913, 26512116, 27819324, 28378740, 29188480, 29632713, 29721043, 30056566, 30463284, 31273952, 31528120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15498560, 22451913, 22791584, 25978366, 26512116, 26695635, 26840086, 27819324, 33406263, 33917174, 36598153	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	28977832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	27322955	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12810637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32544882	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	19666525, 20119625, 25355698, 27206428, 28139689, 28186432, 28839158, 30890547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	12384799, 17229588, 27206428, 28465453, 28484448, 29939755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	31493748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35869130	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28886030, 38183060, 40049807	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25658794, 27569584, 28380460, 28670378, 31493748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	BEFREE	31522278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	34698067	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28712304, 29788500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	28712304	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	19360900		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	25168470, 29429992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	25168470, 29429992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	26944210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	27869342, 30415063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	32313727	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	30400387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic colitis	Colitis	BEFREE	27578867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21401803, 30460757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30754998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	37989825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19302291, 23011546, 31132784, 31289894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33799989, 37049910	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Compensated hemolytic anemia	Hemolytic anemia	BEFREE	12393467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	30415063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Disorders of Glycosylation	Congenital disorder of glycosylation	BEFREE	21614585, 23622397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital dyserythropoietic anemia, type II	Congenital dyserythropoietic anemia	BEFREE	27784127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28097229, 9119739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	17458880	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	22783049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31534047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	CTD_human_DG	31043756		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis Contact	Contact dermatitis	Pubtator	33318199	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	31086953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	31086953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	34698067, 35217004	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	29147614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	28033649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	22734047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	30525058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	30525058, 34424031, 36308193, 36965901	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	25376458, 31493748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	31493748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	32811852	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	30741466	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	20720444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia of Taylor	Focal cortical dysplasia	Pubtator	27095555	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	30954995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	31686549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	12027563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23538445, 25550546, 28076333, 29321087, 29538621, 29754163, 30385739, 30602457, 30898840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	28365151, 35628503	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23538445, 25550546, 28076333, 28834556, 29321087, 29538621, 29754163, 30385739, 30602457, 30898840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29308321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	29463646, 38547058	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease XII	Glycogen storage disease	Pubtator	20967167	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	24021673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	32313727	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	16304383, 21960246, 24487414, 26116271, 28234345, 29067538, 29709247, 31183877, 31686549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	31712778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary spherocytosis	Hereditary Spherocytosis	BEFREE	12176912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary spherocytosis	Hereditary Spherocytosis	LHGDN	12393467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	24334875	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	35301709, 40104289	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	15967379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	BEFREE	30082316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	34698067	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	34698067	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	38183060	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	30816547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	22215724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	23492187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	16564725, 17163870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	21535911, 26077800, 28484448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inclusion Body Myopathy, Sporadic	Inclusion body myopathy	BEFREE	17572512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	LHGDN	17572512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	22783049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	31480863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	31855296	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	27855370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	12351399, 32995942, 36308193	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	19298593, 22813925, 24487414, 29709247, 29743205, 30460757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	23233446, 23320069, 28061465, 29720577, 30539968, 31291985, 32995942, 33592500, 38066884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	15784731	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15380346, 23233446, 23320069, 27869161, 28061465, 30291336, 30539968, 30553527, 30565723, 31183877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	29805639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	29805639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	32313727	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	15498560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24175757, 24523067, 25902734, 27869342, 28036295, 30415063, 30991448, 31646099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	29538440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	38111586	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Obstructive	Lung Diseases	BEFREE	30754998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	31829270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	32043750	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	32082304	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	34068752	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	33765961	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	33799989, 35703112	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	22990013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	BEFREE	22990013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	12351399, 33406263, 34525171, 36389667, 39712032	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	21535911, 24487414, 29709247, 30611570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	30380386, 30464001, 30611570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	30380386, 30464001, 30611570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	29994903, 31712778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Syndrome, X-Linked, 2	Lymphoproliferative Disorder	BEFREE	29743550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20705613, 22451913, 26512116, 26840086, 27819324, 28378740, 29632713, 29721043, 30056566, 30463284, 30723582, 31273952, 31528120, 31689243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	30525058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12384799, 17229588, 28484448, 29939755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	29805639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25658794, 27569584, 28380460, 28670378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	20720442, 20720444, 20720447, 22213040, 28161480, 31139022, 31771616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20698994, 25071009, 28981528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26077800, 28693236, 29536167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	19666525, 20119625, 25355698, 27206428, 28139689, 28186432, 28839158, 30890547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15068902, 15611788, 17573556, 18068526, 18336193, 18497546, 18931663, 18931692, 19298593, 20299817, 22342104, 22451913, 22641236, 23011546, 23690610 View all (71 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	25168470, 29429992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	28100392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	CTD_human_DG	31043756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic Disorder	Manic Disorder	CTD_human_DG	31043756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	29147614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis, Systemic	Mastocytosis	BEFREE	15784688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	27537345	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	14735472, 17168540, 20576118, 22853455, 23774794, 27477289, 28738534, 29050218, 31362997, 31646109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	33009490, 34195295	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	39742254	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	31646109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	17760807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	33828235	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	15725479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	17760807, 1906605, 26036313, 29709247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	17760807, 19661269, 33256380, 36752202	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	17879969, 19952055, 21151203, 22641236, 22734047		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	15380346, 29799854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	29799854, 31917512	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	29749399, 30539968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	28881589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	18953427, 20576118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	32149101	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12591734, 14729615, 16327988, 18336193, 19666525, 20299817, 20698994, 21118954, 22451913, 22641236, 23774794, 24175757, 24911792, 25550546, 25837251 View all (76 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	26575016, 27842053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	28632731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27411490, 28351890, 28632731, 30953647, 31829270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	25914268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	25914268	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	19661269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	26093091, 27129149, 30674867, 31376208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	39594611	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	27569584, 28670378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	25658794		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25658794, 27569584, 28380460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25658794, 31493748	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27569584, 34966389, 37876933, 39608974, 39985839, 7998989	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	30400387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	20720442, 20720444, 20720447, 22213040, 28161480, 31139022, 31771616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma, familial	Pancreatic carcinoma	BEFREE	18497537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	29065481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	BEFREE	27705936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28943253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	31681304	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	18855617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	33799989	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	Pubtator	36734715	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	17412890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Posterior subcapsular cataract	Capsular cataract	BEFREE	31522278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	28977832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	28977832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	30466764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	16358311, 29368647, 29748606, 30460757, 31275386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	29749399, 30539968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	31522278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20698994, 25071009, 28981528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	31214201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	22215724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28097229, 9119739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	24704827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28316886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	36171566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	30674867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	32313727, 35986756	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	38051221	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	17458880	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	30962222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	30962222	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	36399951	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	37270937	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spherocytosis Hereditary	Spherocytosis	Pubtator	12176912	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spherocytosis Hereditary	Spherocytosis	Pubtator	20179084	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spherocytosis Type 4	Spherocytosis	Pubtator	12176912	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	8552191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	29805639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	22641236, 28337964, 29399202, 30741466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18497546, 27322955, 31861233, 34768921	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	18497546, 26573233, 27322955, 29632717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	30816547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26077800, 28693236, 29536167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	33389016, 35703112	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	34698067	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	12902472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	LHGDN	12902472		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	31383641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	39201643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	28589091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	39201643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	29546655, 29569123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	26840086, 28770278, 31452802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26840086	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	27095555	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	22783049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	38078465	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	38183060, 39201801, 40049807	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	18853322, 30653520, 31277366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	30653520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	27742621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	34698067	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CD47 (CD47 molecule)