Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	9603
Gene name	NFE2 like bZIP transcription factor 3
Gene symbol	NFE2L3
Synonyms (NCBI Gene)	NRF3
Chromosome	7
Chromosome location	7p15.2
Summary	This gene encodes a member of the cap `n` collar basic-region leucine zipper family of transcription factors. The encoded protein heterodimerizes with small musculoaponeurotic fibrosarcoma factors to bind antioxidant response elements in target genes. Thi

Show/Hide all (66)

miRTarBase ID	miRNA	Experiments
MIRT1182641	hsa-miR-1264	CLIP-seq
MIRT1182642	hsa-miR-1297	CLIP-seq
MIRT1182643	hsa-miR-1323	CLIP-seq
MIRT1182644	hsa-miR-148a	CLIP-seq
MIRT1182645	hsa-miR-148b	CLIP-seq
MIRT1182646	hsa-miR-152	CLIP-seq
MIRT1182647	hsa-miR-204	CLIP-seq
MIRT1182648	hsa-miR-211	CLIP-seq
MIRT1182649	hsa-miR-26a	CLIP-seq
MIRT1182650	hsa-miR-26b	CLIP-seq
MIRT1182651	hsa-miR-300	CLIP-seq
MIRT1182652	hsa-miR-3074-3p	CLIP-seq
MIRT1182653	hsa-miR-3622a-3p	CLIP-seq
MIRT1182654	hsa-miR-3622b-3p	CLIP-seq
MIRT1182655	hsa-miR-3647-3p	CLIP-seq
MIRT1182656	hsa-miR-381	CLIP-seq
MIRT1182657	hsa-miR-382	CLIP-seq
MIRT1182658	hsa-miR-4272	CLIP-seq
MIRT1182659	hsa-miR-4274	CLIP-seq
MIRT1182660	hsa-miR-4276	CLIP-seq
MIRT1182661	hsa-miR-4282	CLIP-seq
MIRT1182662	hsa-miR-4325	CLIP-seq
MIRT1182663	hsa-miR-433	CLIP-seq
MIRT1182664	hsa-miR-4424	CLIP-seq
MIRT1182665	hsa-miR-4446-5p	CLIP-seq
MIRT1182666	hsa-miR-4465	CLIP-seq
MIRT1182667	hsa-miR-4519	CLIP-seq
MIRT1182668	hsa-miR-4520a-3p	CLIP-seq
MIRT1182669	hsa-miR-4520b-3p	CLIP-seq
MIRT1182670	hsa-miR-4529-3p	CLIP-seq
MIRT1182671	hsa-miR-4666-3p	CLIP-seq
MIRT1182672	hsa-miR-4682	CLIP-seq
MIRT1182673	hsa-miR-4716-5p	CLIP-seq
MIRT1182674	hsa-miR-4755-5p	CLIP-seq
MIRT1182675	hsa-miR-548o	CLIP-seq
MIRT1182676	hsa-miR-548p	CLIP-seq
MIRT1182677	hsa-miR-550b	CLIP-seq
MIRT1182678	hsa-miR-562	CLIP-seq
MIRT1182679	hsa-miR-579	CLIP-seq
MIRT1182680	hsa-miR-587	CLIP-seq
MIRT1182681	hsa-miR-623	CLIP-seq
MIRT1182682	hsa-miR-629	CLIP-seq
MIRT1182642	hsa-miR-1297	CLIP-seq
MIRT1182649	hsa-miR-26a	CLIP-seq
MIRT1182650	hsa-miR-26b	CLIP-seq
MIRT1182658	hsa-miR-4272	CLIP-seq
MIRT1182659	hsa-miR-4274	CLIP-seq
MIRT1182661	hsa-miR-4282	CLIP-seq
MIRT1182664	hsa-miR-4424	CLIP-seq
MIRT1182666	hsa-miR-4465	CLIP-seq
MIRT2053000	hsa-miR-4473	CLIP-seq
MIRT1182667	hsa-miR-4519	CLIP-seq
MIRT1182672	hsa-miR-4682	CLIP-seq
MIRT2053001	hsa-miR-512-3p	CLIP-seq
MIRT2053002	hsa-miR-520f	CLIP-seq
MIRT1182676	hsa-miR-548p	CLIP-seq
MIRT1182678	hsa-miR-562	CLIP-seq
MIRT1182679	hsa-miR-579	CLIP-seq
MIRT2465717	hsa-miR-1251	CLIP-seq
MIRT2465718	hsa-miR-4501	CLIP-seq
MIRT2465719	hsa-miR-4684-5p	CLIP-seq
MIRT2465717	hsa-miR-1251	CLIP-seq
MIRT2686230	hsa-miR-1294	CLIP-seq
MIRT2465718	hsa-miR-4501	CLIP-seq
MIRT2465719	hsa-miR-4684-5p	CLIP-seq
MIRT1182679	hsa-miR-579	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	10037736
GO:0005515	Function	Protein binding	IPI	20102225, 23661758, 28514442, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	20102225, 23661758
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	20102225, 23661758
GO:0006366	Process	Transcription by RNA polymerase II	TAS	10037736
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	20102225, 23661758
GO:0140467	Process	Integrated stress response signaling	NAS	28566324

MIM	HGNC	e!Ensembl
604135	7783	ENSG00000050344

Q9Y4A8

Protein name

Nuclear factor erythroid 2-related factor 3 (NF-E2-related factor 3) (NFE2-related factor 3) (Nuclear factor, erythroid derived 2, like 3)

Protein function

Activates erythroid-specific, globin gene expression.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03131	bZIP_Maf	549 → 642	bZIP Maf transcription factor	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in human placenta and also in B-cell and monocyte cell lines. Low expression in heart, brain, lung, skeletal muscle, kidney and pancreas. {ECO:0000269|PubMed:10037736}.

Sequence

MKHLKRWWSAGGGLLHLTLLLSLAGLRVDLDLYLLLPPPTLLQDELLFLGGPASSAYALS
PFSASGGWGRAGHLHPKGRELDPAAPPEGQLLREVRALGVPFVPRTSVDAWLVHSVAAGS
ADEAHGLLGAAAASSTGGAGASVDGGSQAVQGGGGDPRAARSGPLDAGEEEKAPAEPTAQ
VPDAGGCASEENGVLREKHEAVDHSSQHEENEERVSAQKENSLQQNDDDENKIAEKPDWE
AEKTTESRNERHLNGTDTSFSLEDLFQLLSSQPENSLEGISLGDIPLPGSISDGMNSSAH
YHVNFSQAISQDVNLHEAILLCPNNTFRRDPTARTSQSQEPFLQLNSHTTNPEQTLPGTN
LTGFLSPVDNHMRNLTSQDLLYDLDINIFDEINLMSLATEDNFDPIDVSQLFDEPDSDSG
LSLDSSHNNTSVIKSNSSHSVCDEGAIGYCTDHESSSHHDLEGAVGGYYPEPSKLCHLDQ
SDSDFHGDLTFQHVFHNHTYHLQPTAPESTSEPFPWPGKSQKIRSRYLEDTDRNLSRDEQ
RAKALHIPFSVDEIVGMPVDSFNSMLSRYYLTDLQVSLIRDIRRRGKNKVAAQNCRKRKL
DIILNLEDDVCNLQAKKETLKREQAQCNKAINIMKQKLHDLYHDIFSRLRDDQGRPVNPN
HYALQCTHDGSILIVPKELVASGHKKETQKGKRK

Sequence length

694

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Keratoconus	Likely benign	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (31)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	31693889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31114245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26306035, 35378827	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30886504, 37350063	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36337840	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	38395216	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	31693889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	32123008	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30949407, 31191746, 31742837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31191746, 32123008	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31777602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	30010178	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	36899621	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	21148084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	12588891	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	36337840	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30886504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	30196752	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	21148084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31114245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28970512, 31288376, 31742837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	31693889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35378827	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	34241624	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21148084, 30886504, 31288376, 31742837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	35059466	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30196752	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	21148084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31959204	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34783304	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	37051697	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

NFE2L3 (NFE2 like bZIP transcription factor 3)