CD44 (CD44 molecule (IN blood group))

Gene

• Entrez ID: 960
• Gene name: CD44 molecule (IN blood group)
• Gene symbol: CD44
• Synonyms (NCBI Gene): CDW44, CSPG8, ECM-III, ECMR-III, H-CAM, HCELL, HUTCH-1, HUTCH-I, Hermes-1, LHR, MC56, MDU2, MDU3, MIC4, Pgp1
• Chromosome: 11
• Chromosome location: 11p13
• Summary: The protein encoded by this gene is a cell-surface glycoprotein involved in cell-cell interactions, cell adhesion and migration. It is a receptor for hyaluronic acid (HA) and can also interact with other ligands, such as osteopontin, collagens, and matrix

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000989	hsa-miR-328-3p	Luciferase reporter assay	18560585
MIRT000989	hsa-miR-328-3p	Luciferase reporter assay	18560585
MIRT000989	hsa-miR-328-3p	Luciferase reporter assay	18560585
MIRT000989	hsa-miR-328-3p	Luciferase reporter assay	18560585
MIRT000989	hsa-miR-328-3p	Luciferase reporter assay	18560585
MIRT002428	hsa-miR-373-3p	Review	19935707
MIRT000989	hsa-miR-328-3p	Luciferase reporter assay	18560585
MIRT002428	hsa-miR-373-3p	qRT-PCR	19158933
MIRT002428	hsa-miR-373-3p	qRT-PCR	19158933
MIRT004082	hsa-miR-520c-3p	qRT-PCR	19158933
MIRT004082	hsa-miR-520c-3p	qRT-PCR	19158933
MIRT002428	hsa-miR-373-3p	Western blot	19158933
MIRT004082	hsa-miR-520c-3p	Western blot	19158933
MIRT002428	hsa-miR-373-3p	Luciferase reporter assay	19158933
MIRT004082	hsa-miR-520c-3p	Luciferase reporter assay	19158933
MIRT002428	hsa-miR-373-3p	Luciferase reporter assay, qRT-PCR, Western blot	19158933
MIRT004082	hsa-miR-520c-3p	Luciferase reporter assay, qRT-PCR, Western blot	19158933
MIRT002428	hsa-miR-373-3p	Luciferase reporter assay, Western blot	18193036
MIRT002428	hsa-miR-373-3p	Luciferase reporter assay, Western blot	18193036
MIRT004082	hsa-miR-520c-3p	Luciferase reporter assay, Western blot	18193036
MIRT004082	hsa-miR-520c-3p	Luciferase reporter assay, Western blot	18193036
MIRT003790	hsa-miR-199a-3p	Luciferase reporter assay, qRT-PCR, Western blot	21055388
MIRT005480	hsa-miR-34a-5p	Immunohistochemistry, qRT-PCR, Western blot	21240262
MIRT005967	hsa-miR-608	Immunohistochemistry, Luciferase reporter assay, Western blot	21149267
MIRT005968	hsa-miR-330-3p	Immunohistochemistry, Luciferase reporter assay, Western blot	21149267
MIRT005969	hsa-miR-216a-5p	Immunohistochemistry, Luciferase reporter assay, Western blot	21149267
MIRT006474	hsa-miR-708-5p	PC3	22552290
MIRT006474	hsa-miR-708-5p	PC3	22552290
MIRT006786	hsa-miR-199a-5p	Luciferase reporter assay	22498306
MIRT000989	hsa-miR-328-3p	Reporter assay;Other	18560585
MIRT023486	hsa-miR-1-3p	Proteomics	18668040
MIRT005480	hsa-miR-34a-5p	Reporter assay;Other	21240262
MIRT028389	hsa-miR-30a-5p	Proteomics	18668040
MIRT031409	hsa-miR-16-5p	Proteomics	18668040
MIRT046387	hsa-miR-15b-5p	CLASH	23622248
MIRT044488	hsa-miR-320a	CLASH	23622248
MIRT037402	hsa-miR-744-5p	CLASH	23622248
MIRT053215	hsa-miR-143-3p	Luciferase reporter assay, qRT-PCR, Western blot	23128394
MIRT053216	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR, Western blot	23128394
MIRT000989	hsa-miR-328-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24318997
MIRT000989	hsa-miR-328-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24318997
MIRT000989	hsa-miR-328-3p	Immunohistochemistry, qRT-PCR	25479940
MIRT005480	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24423412
MIRT005480	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24423412
MIRT719264	hsa-miR-188-5p	HITS-CLIP	19536157
MIRT719263	hsa-miR-6866-3p	HITS-CLIP	19536157
MIRT719261	hsa-miR-6832-3p	HITS-CLIP	19536157
MIRT719262	hsa-miR-302b-5p	HITS-CLIP	19536157
MIRT719260	hsa-miR-302d-5p	HITS-CLIP	19536157
MIRT719259	hsa-miR-6716-5p	HITS-CLIP	19536157
MIRT719258	hsa-miR-204-5p	HITS-CLIP	19536157
MIRT719257	hsa-miR-211-5p	HITS-CLIP	19536157
MIRT719256	hsa-miR-552-5p	HITS-CLIP	19536157
MIRT719264	hsa-miR-188-5p	HITS-CLIP	19536157
MIRT719263	hsa-miR-6866-3p	HITS-CLIP	19536157
MIRT719261	hsa-miR-6832-3p	HITS-CLIP	19536157
MIRT719262	hsa-miR-302b-5p	HITS-CLIP	19536157
MIRT719260	hsa-miR-302d-5p	HITS-CLIP	19536157
MIRT719259	hsa-miR-6716-5p	HITS-CLIP	19536157
MIRT719258	hsa-miR-204-5p	HITS-CLIP	19536157
MIRT719257	hsa-miR-211-5p	HITS-CLIP	19536157
MIRT719256	hsa-miR-552-5p	HITS-CLIP	19536157
MIRT616787	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT616786	hsa-miR-4793-5p	HITS-CLIP	23824327
MIRT616785	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT616784	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT616783	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT616782	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT616781	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT664578	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT664577	hsa-miR-5696	HITS-CLIP	23824327
MIRT664576	hsa-miR-579-3p	HITS-CLIP	23824327
MIRT664575	hsa-miR-664b-3p	HITS-CLIP	23824327
MIRT616780	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT664574	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT616779	hsa-miR-192-3p	HITS-CLIP	23824327
MIRT616778	hsa-miR-4642	HITS-CLIP	23824327
MIRT616777	hsa-miR-4776-3p	HITS-CLIP	23824327
MIRT616789	hsa-miR-4802-3p	HITS-CLIP	23824327
MIRT616788	hsa-miR-942-3p	HITS-CLIP	23824327
MIRT616787	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT616786	hsa-miR-4793-5p	HITS-CLIP	23824327
MIRT616785	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT616784	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT616783	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT616782	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT616781	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT616780	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT616779	hsa-miR-192-3p	HITS-CLIP	23824327
MIRT616778	hsa-miR-4642	HITS-CLIP	23824327
MIRT616777	hsa-miR-4776-3p	HITS-CLIP	23824327
MIRT616789	hsa-miR-4802-3p	HITS-CLIP	23824327
MIRT616788	hsa-miR-942-3p	HITS-CLIP	23824327
MIRT616787	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT616786	hsa-miR-4793-5p	HITS-CLIP	23824327
MIRT616785	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT616784	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT616783	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT616782	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT616781	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT616780	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT616779	hsa-miR-192-3p	HITS-CLIP	23824327
MIRT616778	hsa-miR-4642	HITS-CLIP	23824327
MIRT616777	hsa-miR-4776-3p	HITS-CLIP	23824327
MIRT616789	hsa-miR-4802-3p	HITS-CLIP	23824327
MIRT616788	hsa-miR-942-3p	HITS-CLIP	23824327
MIRT616787	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT616786	hsa-miR-4793-5p	HITS-CLIP	23824327
MIRT616785	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT616784	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT616783	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT616782	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT616781	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT616780	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT616779	hsa-miR-192-3p	HITS-CLIP	23824327
MIRT616778	hsa-miR-4642	HITS-CLIP	23824327
MIRT616777	hsa-miR-4776-3p	HITS-CLIP	23824327
MIRT440979	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440979	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT005480	hsa-miR-34a-5p	qRT-PCR, Western blot	25572695
MIRT005480	hsa-miR-34a-5p	Flow, qRT-PCR, Western blot	27497057
MIRT002428	hsa-miR-373-3p	ChIP-seq, Flow, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	27512943
MIRT002428	hsa-miR-373-3p	ChIP-seq, Flow, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	27512943
MIRT005480	hsa-miR-34a-5p	qRT-PCR, Western blot	26231042
MIRT053215	hsa-miR-143-3p	Luciferase reporter assay, qRT-PCR, Western blot	27121210
MIRT053216	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR, Western blot	28428713
MIRT053216	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR, Western blot	28428713
MIRT003790	hsa-miR-199a-3p	Immunocytochemistry, Luciferase reporter assay, qRT-PCR	27447749
MIRT003790	hsa-miR-199a-3p	Immunocytochemistry, Luciferase reporter assay, qRT-PCR	27447749
MIRT004082	hsa-miR-520c-3p	Luciferase reporter assay, qRT-PCR, Western blot	28161058
MIRT005480	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	25551284
MIRT053215	hsa-miR-143-3p	qRT-PCR, Western blot	26722463
MIRT003790	hsa-miR-199a-3p	Immunohistochemistry, Western blot	26079799
MIRT732500	hsa-miR-5580-3p	Microarray	32597160
MIRT733001	hsa-miR-425-5p	qRT-PCR	31673240
MIRT733234	hsa-miR-4287	Luciferase reporter assay, qRT-PCR, Western blotting	34055487
MIRT733279	hsa-miR-138-5p	Luciferase reporter assay, RNA-seq, Western blotting	33911148
MIRT733279	hsa-miR-138-5p	Luciferase reporter assay, RNA-seq, Western blotting	33911148
MIRT733824	hsa-miR-302a-3p	Immunofluorescence, Immunohistochemistry (IHC), Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR, Western blotting	31754405
MIRT005968	hsa-miR-330-3p	Microarray, qRT-PCR	31788082
MIRT736394	hsa-miR-27b-3p	Luciferase reporter assay, Western blotting, qRT-PCR	33291443
MIRT737203	hsa-miR-193b-5p	Luciferase reporter assay, Western blotting, qRT-PCR	31892992
MIRT719264	hsa-miR-188-5p	HITS-CLIP	19536157
MIRT719263	hsa-miR-6866-3p	HITS-CLIP	19536157
MIRT719261	hsa-miR-6832-3p	HITS-CLIP	19536157
MIRT719262	hsa-miR-302b-5p	HITS-CLIP	19536157
MIRT719260	hsa-miR-302d-5p	HITS-CLIP	19536157
MIRT719259	hsa-miR-6716-5p	HITS-CLIP	19536157
MIRT719258	hsa-miR-204-5p	HITS-CLIP	19536157
MIRT719257	hsa-miR-211-5p	HITS-CLIP	19536157
MIRT719256	hsa-miR-552-5p	HITS-CLIP	19536157
MIRT719264	hsa-miR-188-5p	HITS-CLIP	19536157
MIRT719263	hsa-miR-6866-3p	HITS-CLIP	19536157
MIRT719261	hsa-miR-6832-3p	HITS-CLIP	19536157
MIRT719262	hsa-miR-302b-5p	HITS-CLIP	19536157
MIRT719260	hsa-miR-302d-5p	HITS-CLIP	19536157
MIRT719259	hsa-miR-6716-5p	HITS-CLIP	19536157
MIRT719258	hsa-miR-204-5p	HITS-CLIP	19536157
MIRT719257	hsa-miR-211-5p	HITS-CLIP	19536157
MIRT719256	hsa-miR-552-5p	HITS-CLIP	19536157
MIRT616787	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT616786	hsa-miR-4793-5p	HITS-CLIP	23824327
MIRT616785	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT616784	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT616783	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT616782	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT616781	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT664578	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT664577	hsa-miR-5696	HITS-CLIP	23824327
MIRT664576	hsa-miR-579-3p	HITS-CLIP	23824327
MIRT664575	hsa-miR-664b-3p	HITS-CLIP	23824327
MIRT616780	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT664574	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT616779	hsa-miR-192-3p	HITS-CLIP	23824327
MIRT616778	hsa-miR-4642	HITS-CLIP	23824327
MIRT616777	hsa-miR-4776-3p	HITS-CLIP	23824327
MIRT616789	hsa-miR-4802-3p	HITS-CLIP	23824327
MIRT616788	hsa-miR-942-3p	HITS-CLIP	23824327
MIRT616787	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT616786	hsa-miR-4793-5p	HITS-CLIP	23824327
MIRT616785	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT616784	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT616783	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT616782	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT616781	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT616780	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT616779	hsa-miR-192-3p	HITS-CLIP	23824327
MIRT616778	hsa-miR-4642	HITS-CLIP	23824327
MIRT616777	hsa-miR-4776-3p	HITS-CLIP	23824327
MIRT616789	hsa-miR-4802-3p	HITS-CLIP	23824327
MIRT616788	hsa-miR-942-3p	HITS-CLIP	23824327
MIRT616787	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT616786	hsa-miR-4793-5p	HITS-CLIP	23824327
MIRT616785	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT616784	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT616783	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT616782	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT616781	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT616780	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT616779	hsa-miR-192-3p	HITS-CLIP	23824327
MIRT616778	hsa-miR-4642	HITS-CLIP	23824327
MIRT616777	hsa-miR-4776-3p	HITS-CLIP	23824327
MIRT616789	hsa-miR-4802-3p	HITS-CLIP	23824327
MIRT616788	hsa-miR-942-3p	HITS-CLIP	23824327
MIRT616787	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT616786	hsa-miR-4793-5p	HITS-CLIP	23824327
MIRT616785	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT616784	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT616783	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT616782	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT616781	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT616780	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT616779	hsa-miR-192-3p	HITS-CLIP	23824327
MIRT616778	hsa-miR-4642	HITS-CLIP	23824327
MIRT616777	hsa-miR-4776-3p	HITS-CLIP	23824327
MIRT756460	hsa-miR-200c-3p	Western blotting	36995683
MIRT875447	hsa-miR-1238	CLIP-seq
MIRT875448	hsa-miR-1297	CLIP-seq
MIRT875449	hsa-miR-145	CLIP-seq
MIRT875450	hsa-miR-198	CLIP-seq
MIRT875451	hsa-miR-2681	CLIP-seq
MIRT875452	hsa-miR-26a	CLIP-seq
MIRT875453	hsa-miR-26b	CLIP-seq
MIRT875454	hsa-miR-3124-3p	CLIP-seq
MIRT875455	hsa-miR-3125	CLIP-seq
MIRT875456	hsa-miR-3160-5p	CLIP-seq
MIRT875457	hsa-miR-3202	CLIP-seq
MIRT875458	hsa-miR-3916	CLIP-seq
MIRT875459	hsa-miR-4455	CLIP-seq
MIRT875460	hsa-miR-4465	CLIP-seq
MIRT875461	hsa-miR-4476	CLIP-seq
MIRT875462	hsa-miR-4528	CLIP-seq
MIRT875463	hsa-miR-4795-3p	CLIP-seq
MIRT875464	hsa-miR-498	CLIP-seq
MIRT875465	hsa-miR-548aa	CLIP-seq
MIRT875466	hsa-miR-548ac	CLIP-seq
MIRT875467	hsa-miR-548d-3p	CLIP-seq
MIRT875468	hsa-miR-548z	CLIP-seq
MIRT875469	hsa-miR-640	CLIP-seq
MIRT875470	hsa-miR-1182	CLIP-seq
MIRT875471	hsa-miR-1185	CLIP-seq
MIRT875472	hsa-miR-1266	CLIP-seq
MIRT875473	hsa-miR-1273f	CLIP-seq
MIRT875474	hsa-miR-1292	CLIP-seq
MIRT875475	hsa-miR-133a	CLIP-seq
MIRT875476	hsa-miR-133b	CLIP-seq
MIRT875477	hsa-miR-143	CLIP-seq
MIRT875478	hsa-miR-185	CLIP-seq
MIRT875479	hsa-miR-193a-5p	CLIP-seq
MIRT875480	hsa-miR-27a	CLIP-seq
MIRT875481	hsa-miR-27b	CLIP-seq
MIRT875455	hsa-miR-3125	CLIP-seq
MIRT875482	hsa-miR-3151	CLIP-seq
MIRT875483	hsa-miR-3168	CLIP-seq
MIRT875484	hsa-miR-3187-3p	CLIP-seq
MIRT875485	hsa-miR-342-5p	CLIP-seq
MIRT875486	hsa-miR-3610	CLIP-seq
MIRT875487	hsa-miR-3616-5p	CLIP-seq
MIRT875488	hsa-miR-3620	CLIP-seq
MIRT875489	hsa-miR-3647-5p	CLIP-seq
MIRT875490	hsa-miR-3679-5p	CLIP-seq
MIRT875458	hsa-miR-3916	CLIP-seq
MIRT875491	hsa-miR-3921	CLIP-seq
MIRT875492	hsa-miR-3925-5p	CLIP-seq
MIRT875493	hsa-miR-4251	CLIP-seq
MIRT875494	hsa-miR-4265	CLIP-seq
MIRT875495	hsa-miR-4296	CLIP-seq
MIRT875496	hsa-miR-4306	CLIP-seq
MIRT875497	hsa-miR-4322	CLIP-seq
MIRT875498	hsa-miR-4329	CLIP-seq
MIRT875499	hsa-miR-4419a	CLIP-seq
MIRT875500	hsa-miR-4447	CLIP-seq
MIRT875501	hsa-miR-4471	CLIP-seq
MIRT875502	hsa-miR-4472	CLIP-seq
MIRT875503	hsa-miR-4481	CLIP-seq
MIRT875504	hsa-miR-4510	CLIP-seq
MIRT875505	hsa-miR-4517	CLIP-seq
MIRT875506	hsa-miR-4518	CLIP-seq
MIRT875507	hsa-miR-4529-5p	CLIP-seq
MIRT875508	hsa-miR-4644	CLIP-seq
MIRT875509	hsa-miR-4651	CLIP-seq
MIRT875510	hsa-miR-4653-5p	CLIP-seq
MIRT875511	hsa-miR-4664-5p	CLIP-seq
MIRT875512	hsa-miR-4676-5p	CLIP-seq
MIRT875513	hsa-miR-4682	CLIP-seq
MIRT875514	hsa-miR-4708-5p	CLIP-seq
MIRT875515	hsa-miR-4712-5p	CLIP-seq
MIRT875516	hsa-miR-4732-3p	CLIP-seq
MIRT875517	hsa-miR-4745-5p	CLIP-seq
MIRT875518	hsa-miR-4758-5p	CLIP-seq
MIRT875519	hsa-miR-4768-3p	CLIP-seq
MIRT875520	hsa-miR-4770	CLIP-seq
MIRT875521	hsa-miR-4773	CLIP-seq
MIRT875522	hsa-miR-4795-5p	CLIP-seq
MIRT875523	hsa-miR-491-5p	CLIP-seq
MIRT875524	hsa-miR-510	CLIP-seq
MIRT875525	hsa-miR-513a-5p	CLIP-seq
MIRT875526	hsa-miR-552	CLIP-seq
MIRT875527	hsa-miR-573	CLIP-seq
MIRT875528	hsa-miR-575	CLIP-seq
MIRT875529	hsa-miR-593	CLIP-seq
MIRT875530	hsa-miR-770-5p	CLIP-seq
MIRT875531	hsa-miR-877	CLIP-seq
MIRT875532	hsa-miR-1303	CLIP-seq
MIRT875533	hsa-miR-1587	CLIP-seq
MIRT875534	hsa-miR-3179	CLIP-seq
MIRT875535	hsa-miR-3662	CLIP-seq
MIRT875536	hsa-miR-3915	CLIP-seq
MIRT875537	hsa-miR-3928	CLIP-seq
MIRT875538	hsa-miR-4492	CLIP-seq
MIRT875539	hsa-miR-4498	CLIP-seq
MIRT875540	hsa-miR-4656	CLIP-seq
MIRT875541	hsa-miR-4668-5p	CLIP-seq
MIRT875542	hsa-miR-4675	CLIP-seq
MIRT875543	hsa-miR-4741	CLIP-seq
MIRT875544	hsa-miR-762	CLIP-seq
MIRT1959534	hsa-miR-1262	CLIP-seq
MIRT1959535	hsa-miR-1275	CLIP-seq
MIRT1959536	hsa-miR-1279	CLIP-seq
MIRT1959537	hsa-miR-138	CLIP-seq
MIRT1959538	hsa-miR-150	CLIP-seq
MIRT1959539	hsa-miR-2115	CLIP-seq
MIRT1959540	hsa-miR-296-5p	CLIP-seq
MIRT1959541	hsa-miR-3064-3p	CLIP-seq
MIRT1959542	hsa-miR-3121-3p	CLIP-seq
MIRT1959543	hsa-miR-3136-5p	CLIP-seq
MIRT1959544	hsa-miR-3153	CLIP-seq
MIRT1959545	hsa-miR-3164	CLIP-seq
MIRT1959546	hsa-miR-3189-3p	CLIP-seq
MIRT875488	hsa-miR-3620	CLIP-seq
MIRT1959547	hsa-miR-3688-3p	CLIP-seq
MIRT1959548	hsa-miR-3908	CLIP-seq
MIRT1959549	hsa-miR-3920	CLIP-seq
MIRT1959550	hsa-miR-409-3p	CLIP-seq
MIRT1959551	hsa-miR-412	CLIP-seq
MIRT1959552	hsa-miR-4254	CLIP-seq
MIRT1959553	hsa-miR-4282	CLIP-seq
MIRT1959554	hsa-miR-4292	CLIP-seq
MIRT1959555	hsa-miR-4436a	CLIP-seq
MIRT1959556	hsa-miR-4439	CLIP-seq
MIRT875500	hsa-miR-4447	CLIP-seq
MIRT875459	hsa-miR-4455	CLIP-seq
MIRT1959557	hsa-miR-4456	CLIP-seq
MIRT875502	hsa-miR-4472	CLIP-seq
MIRT1959558	hsa-miR-4474-5p	CLIP-seq
MIRT1959559	hsa-miR-4477a	CLIP-seq
MIRT1959560	hsa-miR-4502	CLIP-seq
MIRT1959561	hsa-miR-4513	CLIP-seq
MIRT1959562	hsa-miR-4525	CLIP-seq
MIRT1959563	hsa-miR-4646-5p	CLIP-seq
MIRT1959564	hsa-miR-4665-5p	CLIP-seq
MIRT875541	hsa-miR-4668-5p	CLIP-seq
MIRT1959565	hsa-miR-4701-3p	CLIP-seq
MIRT1959566	hsa-miR-4713-5p	CLIP-seq
MIRT1959567	hsa-miR-4714-5p	CLIP-seq
MIRT1959568	hsa-miR-4723-5p	CLIP-seq
MIRT875516	hsa-miR-4732-3p	CLIP-seq
MIRT1959569	hsa-miR-4766-5p	CLIP-seq
MIRT1959570	hsa-miR-4772-5p	CLIP-seq
MIRT1959571	hsa-miR-513a-3p	CLIP-seq
MIRT1959572	hsa-miR-532-3p	CLIP-seq
MIRT1959573	hsa-miR-541	CLIP-seq
MIRT1959574	hsa-miR-577	CLIP-seq
MIRT1959575	hsa-miR-609	CLIP-seq
MIRT1959576	hsa-miR-625	CLIP-seq
MIRT1959577	hsa-miR-628-5p	CLIP-seq
MIRT1959578	hsa-miR-654-5p	CLIP-seq
MIRT1959579	hsa-miR-665	CLIP-seq
MIRT1959580	hsa-miR-873	CLIP-seq
MIRT875447	hsa-miR-1238	CLIP-seq
MIRT2427171	hsa-miR-1257	CLIP-seq
MIRT2427172	hsa-miR-132	CLIP-seq
MIRT2427173	hsa-miR-1323	CLIP-seq
MIRT2427174	hsa-miR-199b-3p	CLIP-seq
MIRT2427175	hsa-miR-212	CLIP-seq
MIRT875451	hsa-miR-2681	CLIP-seq
MIRT2427176	hsa-miR-3120-3p	CLIP-seq
MIRT1959542	hsa-miR-3121-3p	CLIP-seq
MIRT875454	hsa-miR-3124-3p	CLIP-seq
MIRT2427177	hsa-miR-3129-5p	CLIP-seq
MIRT875456	hsa-miR-3160-5p	CLIP-seq
MIRT875483	hsa-miR-3168	CLIP-seq
MIRT2427178	hsa-miR-3194-3p	CLIP-seq
MIRT2427179	hsa-miR-339-5p	CLIP-seq
MIRT2427180	hsa-miR-3545-5p	CLIP-seq
MIRT2427181	hsa-miR-3613-3p	CLIP-seq
MIRT2427182	hsa-miR-3617	CLIP-seq
MIRT2427183	hsa-miR-371b-5p	CLIP-seq
MIRT2427184	hsa-miR-3941	CLIP-seq
MIRT2427185	hsa-miR-3973	CLIP-seq
MIRT2427186	hsa-miR-4267	CLIP-seq
MIRT2427187	hsa-miR-4289	CLIP-seq
MIRT2427188	hsa-miR-4307	CLIP-seq
MIRT875462	hsa-miR-4528	CLIP-seq
MIRT2427189	hsa-miR-466	CLIP-seq
MIRT2427190	hsa-miR-4672	CLIP-seq
MIRT2427191	hsa-miR-4685-5p	CLIP-seq
MIRT2427192	hsa-miR-4731-3p	CLIP-seq
MIRT1959569	hsa-miR-4766-5p	CLIP-seq
MIRT2427193	hsa-miR-4790-3p	CLIP-seq
MIRT875463	hsa-miR-4795-3p	CLIP-seq
MIRT2427194	hsa-miR-4801	CLIP-seq
MIRT2427195	hsa-miR-4803	CLIP-seq
MIRT2427196	hsa-miR-494	CLIP-seq
MIRT2427197	hsa-miR-520g	CLIP-seq
MIRT2427198	hsa-miR-520h	CLIP-seq
MIRT2427199	hsa-miR-548a-5p	CLIP-seq
MIRT2427200	hsa-miR-548ab	CLIP-seq
MIRT2427201	hsa-miR-548ak	CLIP-seq
MIRT2427202	hsa-miR-548b-5p	CLIP-seq
MIRT2427203	hsa-miR-548c-5p	CLIP-seq
MIRT2427204	hsa-miR-548d-5p	CLIP-seq
MIRT2427205	hsa-miR-548h	CLIP-seq
MIRT2427206	hsa-miR-548i	CLIP-seq
MIRT2427207	hsa-miR-548j	CLIP-seq
MIRT2427208	hsa-miR-548m	CLIP-seq
MIRT2427209	hsa-miR-548o	CLIP-seq
MIRT2427210	hsa-miR-548w	CLIP-seq
MIRT2427211	hsa-miR-548y	CLIP-seq
MIRT2427212	hsa-miR-559	CLIP-seq
MIRT2427213	hsa-miR-570	CLIP-seq
MIRT1959574	hsa-miR-577	CLIP-seq
MIRT2427214	hsa-miR-607	CLIP-seq
MIRT2427215	hsa-miR-616	CLIP-seq
MIRT2427216	hsa-miR-629	CLIP-seq
MIRT875469	hsa-miR-640	CLIP-seq
MIRT2427217	hsa-miR-641	CLIP-seq
MIRT2427218	hsa-miR-802	CLIP-seq
MIRT2427219	hsa-miR-888	CLIP-seq
MIRT2427220	hsa-miR-889	CLIP-seq
MIRT2427221	hsa-miR-936	CLIP-seq
MIRT875454	hsa-miR-3124-3p	CLIP-seq
MIRT2499519	hsa-miR-105	CLIP-seq
MIRT875471	hsa-miR-1185	CLIP-seq
MIRT2499520	hsa-miR-122	CLIP-seq
MIRT875447	hsa-miR-1238	CLIP-seq
MIRT2499521	hsa-miR-124	CLIP-seq
MIRT2499522	hsa-miR-1253	CLIP-seq
MIRT2427171	hsa-miR-1257	CLIP-seq
MIRT1959534	hsa-miR-1262	CLIP-seq
MIRT2499523	hsa-miR-1267	CLIP-seq
MIRT2499524	hsa-miR-1273	CLIP-seq
MIRT2499525	hsa-miR-1276	CLIP-seq
MIRT2499526	hsa-miR-1305	CLIP-seq
MIRT2427172	hsa-miR-132	CLIP-seq
MIRT2499527	hsa-miR-1324	CLIP-seq
MIRT875475	hsa-miR-133a	CLIP-seq
MIRT875476	hsa-miR-133b	CLIP-seq
MIRT1959537	hsa-miR-138	CLIP-seq
MIRT2499528	hsa-miR-139-5p	CLIP-seq
MIRT2499529	hsa-miR-144	CLIP-seq
MIRT1959538	hsa-miR-150	CLIP-seq
MIRT875478	hsa-miR-185	CLIP-seq
MIRT2499530	hsa-miR-1912	CLIP-seq
MIRT2499531	hsa-miR-1915	CLIP-seq
MIRT2427174	hsa-miR-199b-3p	CLIP-seq
MIRT2499532	hsa-miR-202	CLIP-seq
MIRT2499533	hsa-miR-204	CLIP-seq
MIRT2499534	hsa-miR-211	CLIP-seq
MIRT2499535	hsa-miR-2113	CLIP-seq
MIRT2427175	hsa-miR-212	CLIP-seq
MIRT2499536	hsa-miR-216b	CLIP-seq
MIRT2499537	hsa-miR-224	CLIP-seq
MIRT2499538	hsa-miR-2355-3p	CLIP-seq
MIRT2499539	hsa-miR-2467-3p	CLIP-seq
MIRT875480	hsa-miR-27a	CLIP-seq
MIRT875481	hsa-miR-27b	CLIP-seq
MIRT2499540	hsa-miR-28-5p	CLIP-seq
MIRT1959540	hsa-miR-296-5p	CLIP-seq
MIRT2499541	hsa-miR-299-5p	CLIP-seq
MIRT1959541	hsa-miR-3064-3p	CLIP-seq
MIRT2499542	hsa-miR-3120-5p	CLIP-seq
MIRT1959542	hsa-miR-3121-3p	CLIP-seq
MIRT875454	hsa-miR-3124-3p	CLIP-seq
MIRT875455	hsa-miR-3125	CLIP-seq
MIRT2499543	hsa-miR-3126-3p	CLIP-seq
MIRT2499544	hsa-miR-3126-5p	CLIP-seq
MIRT2427177	hsa-miR-3129-5p	CLIP-seq
MIRT2499545	hsa-miR-3139	CLIP-seq
MIRT2499546	hsa-miR-3140-3p	CLIP-seq
MIRT2499547	hsa-miR-3145-3p	CLIP-seq
MIRT875482	hsa-miR-3151	CLIP-seq
MIRT1959544	hsa-miR-3153	CLIP-seq
MIRT2499548	hsa-miR-3161	CLIP-seq
MIRT875483	hsa-miR-3168	CLIP-seq
MIRT2499549	hsa-miR-3176	CLIP-seq
MIRT2499550	hsa-miR-3180	CLIP-seq
MIRT2499551	hsa-miR-3180-3p	CLIP-seq
MIRT2499552	hsa-miR-3180-5p	CLIP-seq
MIRT2499553	hsa-miR-3183	CLIP-seq
MIRT2499554	hsa-miR-3185	CLIP-seq
MIRT2499555	hsa-miR-3196	CLIP-seq
MIRT2499556	hsa-miR-331-5p	CLIP-seq
MIRT2427179	hsa-miR-339-5p	CLIP-seq
MIRT875485	hsa-miR-342-5p	CLIP-seq
MIRT2499557	hsa-miR-34c-3p	CLIP-seq
MIRT2499558	hsa-miR-3529	CLIP-seq
MIRT875486	hsa-miR-3610	CLIP-seq
MIRT2427181	hsa-miR-3613-3p	CLIP-seq
MIRT2499559	hsa-miR-3613-5p	CLIP-seq
MIRT875487	hsa-miR-3616-5p	CLIP-seq
MIRT2427182	hsa-miR-3617	CLIP-seq
MIRT2499560	hsa-miR-3619-3p	CLIP-seq
MIRT875488	hsa-miR-3620	CLIP-seq
MIRT2499561	hsa-miR-3647-3p	CLIP-seq
MIRT875489	hsa-miR-3647-5p	CLIP-seq
MIRT2499562	hsa-miR-3650	CLIP-seq
MIRT2499563	hsa-miR-3657	CLIP-seq
MIRT2499564	hsa-miR-3664-5p	CLIP-seq
MIRT2499565	hsa-miR-3671	CLIP-seq
MIRT2499566	hsa-miR-3672	CLIP-seq
MIRT875490	hsa-miR-3679-5p	CLIP-seq
MIRT2499567	hsa-miR-3684	CLIP-seq
MIRT2499568	hsa-miR-3690	CLIP-seq
MIRT2499569	hsa-miR-3691-3p	CLIP-seq
MIRT2499570	hsa-miR-379	CLIP-seq
MIRT1959548	hsa-miR-3908	CLIP-seq
MIRT2499571	hsa-miR-3913-3p	CLIP-seq
MIRT875458	hsa-miR-3916	CLIP-seq
MIRT1959549	hsa-miR-3920	CLIP-seq
MIRT2499572	hsa-miR-3922-3p	CLIP-seq
MIRT2499573	hsa-miR-3923	CLIP-seq
MIRT2499574	hsa-miR-3926	CLIP-seq
MIRT2499575	hsa-miR-3927	CLIP-seq
MIRT2427184	hsa-miR-3941	CLIP-seq
MIRT2499576	hsa-miR-3942-3p	CLIP-seq
MIRT2427185	hsa-miR-3973	CLIP-seq
MIRT1959550	hsa-miR-409-3p	CLIP-seq
MIRT2499577	hsa-miR-410	CLIP-seq
MIRT1959551	hsa-miR-412	CLIP-seq
MIRT875493	hsa-miR-4251	CLIP-seq
MIRT1959552	hsa-miR-4254	CLIP-seq
MIRT2499578	hsa-miR-4257	CLIP-seq
MIRT875494	hsa-miR-4265	CLIP-seq
MIRT2427186	hsa-miR-4267	CLIP-seq
MIRT1959553	hsa-miR-4282	CLIP-seq
MIRT1959554	hsa-miR-4292	CLIP-seq
MIRT875495	hsa-miR-4296	CLIP-seq
MIRT2499579	hsa-miR-4299	CLIP-seq
MIRT2499580	hsa-miR-4305	CLIP-seq
MIRT875496	hsa-miR-4306	CLIP-seq
MIRT2427188	hsa-miR-4307	CLIP-seq
MIRT2499581	hsa-miR-4308	CLIP-seq
MIRT2499582	hsa-miR-4311	CLIP-seq
MIRT2499583	hsa-miR-4317	CLIP-seq
MIRT875497	hsa-miR-4322	CLIP-seq
MIRT2499584	hsa-miR-4328	CLIP-seq
MIRT875498	hsa-miR-4329	CLIP-seq
MIRT875499	hsa-miR-4419a	CLIP-seq
MIRT2499585	hsa-miR-4433	CLIP-seq
MIRT875500	hsa-miR-4447	CLIP-seq
MIRT2499586	hsa-miR-4451	CLIP-seq
MIRT875459	hsa-miR-4455	CLIP-seq
MIRT1959557	hsa-miR-4456	CLIP-seq
MIRT2499587	hsa-miR-4459	CLIP-seq
MIRT2499588	hsa-miR-4468	CLIP-seq
MIRT2499589	hsa-miR-4469	CLIP-seq
MIRT875502	hsa-miR-4472	CLIP-seq
MIRT1959559	hsa-miR-4477a	CLIP-seq
MIRT2499590	hsa-miR-4480	CLIP-seq
MIRT2499591	hsa-miR-4503	CLIP-seq
MIRT2499592	hsa-miR-4505	CLIP-seq
MIRT875504	hsa-miR-4510	CLIP-seq
MIRT875505	hsa-miR-4517	CLIP-seq
MIRT2499593	hsa-miR-4527	CLIP-seq
MIRT2499594	hsa-miR-4535	CLIP-seq
MIRT875508	hsa-miR-4644	CLIP-seq
MIRT1959563	hsa-miR-4646-5p	CLIP-seq
MIRT875509	hsa-miR-4651	CLIP-seq
MIRT2499595	hsa-miR-4659a-3p	CLIP-seq
MIRT2499596	hsa-miR-4659b-3p	CLIP-seq
MIRT2427189	hsa-miR-466	CLIP-seq
MIRT875511	hsa-miR-4664-5p	CLIP-seq
MIRT875541	hsa-miR-4668-5p	CLIP-seq
MIRT2427190	hsa-miR-4672	CLIP-seq
MIRT875512	hsa-miR-4676-5p	CLIP-seq
MIRT2499597	hsa-miR-4685-3p	CLIP-seq
MIRT2427191	hsa-miR-4685-5p	CLIP-seq
MIRT2499598	hsa-miR-4687-3p	CLIP-seq
MIRT2499599	hsa-miR-4691-5p	CLIP-seq
MIRT2499600	hsa-miR-4694-3p	CLIP-seq
MIRT2499601	hsa-miR-4699-5p	CLIP-seq
MIRT1959565	hsa-miR-4701-3p	CLIP-seq
MIRT2499602	hsa-miR-4709-3p	CLIP-seq
MIRT875515	hsa-miR-4712-5p	CLIP-seq
MIRT1959566	hsa-miR-4713-5p	CLIP-seq
MIRT2499603	hsa-miR-4716-5p	CLIP-seq
MIRT2499604	hsa-miR-4723-3p	CLIP-seq
MIRT2499605	hsa-miR-4726-3p	CLIP-seq
MIRT2427192	hsa-miR-4731-3p	CLIP-seq
MIRT2499606	hsa-miR-4735-5p	CLIP-seq
MIRT2499607	hsa-miR-4738-3p	CLIP-seq
MIRT1959569	hsa-miR-4766-5p	CLIP-seq
MIRT875519	hsa-miR-4768-3p	CLIP-seq
MIRT2499608	hsa-miR-4774-3p	CLIP-seq
MIRT2499609	hsa-miR-4776-5p	CLIP-seq
MIRT2499610	hsa-miR-4777-5p	CLIP-seq
MIRT2499611	hsa-miR-4778-3p	CLIP-seq
MIRT2499612	hsa-miR-4781-3p	CLIP-seq
MIRT2427193	hsa-miR-4790-3p	CLIP-seq
MIRT875463	hsa-miR-4795-3p	CLIP-seq
MIRT875522	hsa-miR-4795-5p	CLIP-seq
MIRT2427194	hsa-miR-4801	CLIP-seq
MIRT2427195	hsa-miR-4803	CLIP-seq
MIRT2499613	hsa-miR-485-5p	CLIP-seq
MIRT2499614	hsa-miR-489	CLIP-seq
MIRT875523	hsa-miR-491-5p	CLIP-seq
MIRT2499615	hsa-miR-492	CLIP-seq
MIRT2427196	hsa-miR-494	CLIP-seq
MIRT2499616	hsa-miR-495	CLIP-seq
MIRT875464	hsa-miR-498	CLIP-seq
MIRT2499617	hsa-miR-506	CLIP-seq
MIRT2499618	hsa-miR-512-3p	CLIP-seq
MIRT1959571	hsa-miR-513a-3p	CLIP-seq
MIRT875525	hsa-miR-513a-5p	CLIP-seq
MIRT2499619	hsa-miR-518d-5p	CLIP-seq
MIRT2499620	hsa-miR-519b-5p	CLIP-seq
MIRT2499621	hsa-miR-519c-5p	CLIP-seq
MIRT2499622	hsa-miR-520a-5p	CLIP-seq
MIRT2499623	hsa-miR-520c-5p	CLIP-seq
MIRT2499624	hsa-miR-520d-5p	CLIP-seq
MIRT2499625	hsa-miR-524-5p	CLIP-seq
MIRT2499626	hsa-miR-525-5p	CLIP-seq
MIRT2499627	hsa-miR-526a	CLIP-seq
MIRT1959572	hsa-miR-532-3p	CLIP-seq
MIRT2499628	hsa-miR-544	CLIP-seq
MIRT2427199	hsa-miR-548a-5p	CLIP-seq
MIRT2427200	hsa-miR-548ab	CLIP-seq
MIRT2427201	hsa-miR-548ak	CLIP-seq
MIRT2499629	hsa-miR-548an	CLIP-seq
MIRT2427202	hsa-miR-548b-5p	CLIP-seq
MIRT2499630	hsa-miR-548c-3p	CLIP-seq
MIRT2427203	hsa-miR-548c-5p	CLIP-seq
MIRT2427204	hsa-miR-548d-5p	CLIP-seq
MIRT2427205	hsa-miR-548h	CLIP-seq
MIRT2427206	hsa-miR-548i	CLIP-seq
MIRT2427207	hsa-miR-548j	CLIP-seq
MIRT2427208	hsa-miR-548m	CLIP-seq
MIRT2499631	hsa-miR-548q	CLIP-seq
MIRT2499632	hsa-miR-548s	CLIP-seq
MIRT2427210	hsa-miR-548w	CLIP-seq
MIRT2427211	hsa-miR-548y	CLIP-seq
MIRT2499633	hsa-miR-550a	CLIP-seq
MIRT2427212	hsa-miR-559	CLIP-seq
MIRT2427213	hsa-miR-570	CLIP-seq
MIRT875527	hsa-miR-573	CLIP-seq
MIRT875528	hsa-miR-575	CLIP-seq
MIRT2499634	hsa-miR-576-3p	CLIP-seq
MIRT1959574	hsa-miR-577	CLIP-seq
MIRT2499635	hsa-miR-579	CLIP-seq
MIRT2499636	hsa-miR-583	CLIP-seq
MIRT2499637	hsa-miR-587	CLIP-seq
MIRT2499638	hsa-miR-591	CLIP-seq
MIRT2499639	hsa-miR-595	CLIP-seq
MIRT2427214	hsa-miR-607	CLIP-seq
MIRT1959575	hsa-miR-609	CLIP-seq
MIRT1959577	hsa-miR-628-5p	CLIP-seq
MIRT2427216	hsa-miR-629	CLIP-seq
MIRT875469	hsa-miR-640	CLIP-seq
MIRT2427217	hsa-miR-641	CLIP-seq
MIRT2499640	hsa-miR-643	CLIP-seq
MIRT2499641	hsa-miR-653	CLIP-seq
MIRT2499642	hsa-miR-660	CLIP-seq
MIRT2499643	hsa-miR-676	CLIP-seq
MIRT2499644	hsa-miR-708	CLIP-seq
MIRT2499645	hsa-miR-711	CLIP-seq
MIRT875530	hsa-miR-770-5p	CLIP-seq
MIRT875531	hsa-miR-877	CLIP-seq
MIRT2427220	hsa-miR-889	CLIP-seq
MIRT2499646	hsa-miR-935	CLIP-seq
MIRT2427221	hsa-miR-936	CLIP-seq
MIRT2499647	hsa-miR-942	CLIP-seq
MIRT2499519	hsa-miR-105	CLIP-seq
MIRT875471	hsa-miR-1185	CLIP-seq
MIRT2499520	hsa-miR-122	CLIP-seq
MIRT875447	hsa-miR-1238	CLIP-seq
MIRT2499521	hsa-miR-124	CLIP-seq
MIRT2499522	hsa-miR-1253	CLIP-seq
MIRT2427171	hsa-miR-1257	CLIP-seq
MIRT1959534	hsa-miR-1262	CLIP-seq
MIRT2499523	hsa-miR-1267	CLIP-seq
MIRT2499524	hsa-miR-1273	CLIP-seq
MIRT2499525	hsa-miR-1276	CLIP-seq
MIRT1959536	hsa-miR-1279	CLIP-seq
MIRT2677712	hsa-miR-1304	CLIP-seq
MIRT2499526	hsa-miR-1305	CLIP-seq
MIRT2677713	hsa-miR-130a	CLIP-seq
MIRT2677714	hsa-miR-130b	CLIP-seq
MIRT2427172	hsa-miR-132	CLIP-seq
MIRT2499527	hsa-miR-1324	CLIP-seq
MIRT875475	hsa-miR-133a	CLIP-seq
MIRT875476	hsa-miR-133b	CLIP-seq
MIRT1959537	hsa-miR-138	CLIP-seq
MIRT2499528	hsa-miR-139-5p	CLIP-seq
MIRT2499529	hsa-miR-144	CLIP-seq
MIRT1959538	hsa-miR-150	CLIP-seq
MIRT875478	hsa-miR-185	CLIP-seq
MIRT2499530	hsa-miR-1912	CLIP-seq
MIRT2427174	hsa-miR-199b-3p	CLIP-seq
MIRT2499532	hsa-miR-202	CLIP-seq
MIRT2499533	hsa-miR-204	CLIP-seq
MIRT2499534	hsa-miR-211	CLIP-seq
MIRT2499535	hsa-miR-2113	CLIP-seq
MIRT2427175	hsa-miR-212	CLIP-seq
MIRT2499536	hsa-miR-216b	CLIP-seq
MIRT2499537	hsa-miR-224	CLIP-seq
MIRT2499538	hsa-miR-2355-3p	CLIP-seq
MIRT2499539	hsa-miR-2467-3p	CLIP-seq
MIRT875480	hsa-miR-27a	CLIP-seq
MIRT875481	hsa-miR-27b	CLIP-seq
MIRT2499540	hsa-miR-28-5p	CLIP-seq
MIRT1959540	hsa-miR-296-5p	CLIP-seq
MIRT2677715	hsa-miR-298	CLIP-seq
MIRT2499541	hsa-miR-299-5p	CLIP-seq
MIRT2677716	hsa-miR-301a	CLIP-seq
MIRT2677717	hsa-miR-301b	CLIP-seq
MIRT1959541	hsa-miR-3064-3p	CLIP-seq
MIRT2499542	hsa-miR-3120-5p	CLIP-seq
MIRT1959542	hsa-miR-3121-3p	CLIP-seq
MIRT875454	hsa-miR-3124-3p	CLIP-seq
MIRT875455	hsa-miR-3125	CLIP-seq
MIRT2499543	hsa-miR-3126-3p	CLIP-seq
MIRT2499544	hsa-miR-3126-5p	CLIP-seq
MIRT2427177	hsa-miR-3129-5p	CLIP-seq
MIRT2499545	hsa-miR-3139	CLIP-seq
MIRT2499546	hsa-miR-3140-3p	CLIP-seq
MIRT2499547	hsa-miR-3145-3p	CLIP-seq
MIRT875482	hsa-miR-3151	CLIP-seq
MIRT2499548	hsa-miR-3161	CLIP-seq
MIRT875483	hsa-miR-3168	CLIP-seq
MIRT2677718	hsa-miR-3169	CLIP-seq
MIRT2499549	hsa-miR-3176	CLIP-seq
MIRT2499550	hsa-miR-3180	CLIP-seq
MIRT2499551	hsa-miR-3180-3p	CLIP-seq
MIRT2499552	hsa-miR-3180-5p	CLIP-seq
MIRT2499553	hsa-miR-3183	CLIP-seq
MIRT2499554	hsa-miR-3185	CLIP-seq
MIRT2499555	hsa-miR-3196	CLIP-seq
MIRT2499556	hsa-miR-331-5p	CLIP-seq
MIRT2427179	hsa-miR-339-5p	CLIP-seq
MIRT875485	hsa-miR-342-5p	CLIP-seq
MIRT2499557	hsa-miR-34c-3p	CLIP-seq
MIRT2499558	hsa-miR-3529	CLIP-seq
MIRT875486	hsa-miR-3610	CLIP-seq
MIRT2427181	hsa-miR-3613-3p	CLIP-seq
MIRT2499559	hsa-miR-3613-5p	CLIP-seq
MIRT875487	hsa-miR-3616-5p	CLIP-seq
MIRT2427182	hsa-miR-3617	CLIP-seq
MIRT2499560	hsa-miR-3619-3p	CLIP-seq
MIRT875488	hsa-miR-3620	CLIP-seq
MIRT2499561	hsa-miR-3647-3p	CLIP-seq
MIRT875489	hsa-miR-3647-5p	CLIP-seq
MIRT2499562	hsa-miR-3650	CLIP-seq
MIRT2499563	hsa-miR-3657	CLIP-seq
MIRT2677719	hsa-miR-3660	CLIP-seq
MIRT2499564	hsa-miR-3664-5p	CLIP-seq
MIRT2677720	hsa-miR-3666	CLIP-seq
MIRT2499566	hsa-miR-3672	CLIP-seq
MIRT875490	hsa-miR-3679-5p	CLIP-seq
MIRT2499567	hsa-miR-3684	CLIP-seq
MIRT2499568	hsa-miR-3690	CLIP-seq
MIRT2499569	hsa-miR-3691-3p	CLIP-seq
MIRT2499570	hsa-miR-379	CLIP-seq
MIRT1959548	hsa-miR-3908	CLIP-seq
MIRT2499571	hsa-miR-3913-3p	CLIP-seq
MIRT875458	hsa-miR-3916	CLIP-seq
MIRT1959549	hsa-miR-3920	CLIP-seq
MIRT2499572	hsa-miR-3922-3p	CLIP-seq
MIRT2499573	hsa-miR-3923	CLIP-seq
MIRT2499574	hsa-miR-3926	CLIP-seq
MIRT2499575	hsa-miR-3927	CLIP-seq
MIRT2427184	hsa-miR-3941	CLIP-seq
MIRT2499576	hsa-miR-3942-3p	CLIP-seq
MIRT2427185	hsa-miR-3973	CLIP-seq
MIRT1959550	hsa-miR-409-3p	CLIP-seq
MIRT2499577	hsa-miR-410	CLIP-seq
MIRT1959551	hsa-miR-412	CLIP-seq
MIRT875493	hsa-miR-4251	CLIP-seq
MIRT1959552	hsa-miR-4254	CLIP-seq
MIRT2499578	hsa-miR-4257	CLIP-seq
MIRT875494	hsa-miR-4265	CLIP-seq
MIRT2427186	hsa-miR-4267	CLIP-seq
MIRT1959553	hsa-miR-4282	CLIP-seq
MIRT1959554	hsa-miR-4292	CLIP-seq
MIRT2677721	hsa-miR-4295	CLIP-seq
MIRT875495	hsa-miR-4296	CLIP-seq
MIRT2499579	hsa-miR-4299	CLIP-seq
MIRT2499580	hsa-miR-4305	CLIP-seq
MIRT875496	hsa-miR-4306	CLIP-seq
MIRT2427188	hsa-miR-4307	CLIP-seq
MIRT2499581	hsa-miR-4308	CLIP-seq
MIRT2499582	hsa-miR-4311	CLIP-seq
MIRT2499583	hsa-miR-4317	CLIP-seq
MIRT875497	hsa-miR-4322	CLIP-seq
MIRT2499584	hsa-miR-4328	CLIP-seq
MIRT875498	hsa-miR-4329	CLIP-seq
MIRT875499	hsa-miR-4419a	CLIP-seq
MIRT2499585	hsa-miR-4433	CLIP-seq
MIRT875500	hsa-miR-4447	CLIP-seq
MIRT2499586	hsa-miR-4451	CLIP-seq
MIRT875459	hsa-miR-4455	CLIP-seq
MIRT1959557	hsa-miR-4456	CLIP-seq
MIRT2499587	hsa-miR-4459	CLIP-seq
MIRT2499588	hsa-miR-4468	CLIP-seq
MIRT2499589	hsa-miR-4469	CLIP-seq
MIRT875502	hsa-miR-4472	CLIP-seq
MIRT1959559	hsa-miR-4477a	CLIP-seq
MIRT2499590	hsa-miR-4480	CLIP-seq
MIRT2499591	hsa-miR-4503	CLIP-seq
MIRT2499592	hsa-miR-4505	CLIP-seq
MIRT875504	hsa-miR-4510	CLIP-seq
MIRT875505	hsa-miR-4517	CLIP-seq
MIRT2677722	hsa-miR-4526	CLIP-seq
MIRT2499593	hsa-miR-4527	CLIP-seq
MIRT2499594	hsa-miR-4535	CLIP-seq
MIRT2677723	hsa-miR-454	CLIP-seq
MIRT875508	hsa-miR-4644	CLIP-seq
MIRT1959563	hsa-miR-4646-5p	CLIP-seq
MIRT875509	hsa-miR-4651	CLIP-seq
MIRT2499595	hsa-miR-4659a-3p	CLIP-seq
MIRT2499596	hsa-miR-4659b-3p	CLIP-seq
MIRT2427189	hsa-miR-466	CLIP-seq
MIRT875511	hsa-miR-4664-5p	CLIP-seq
MIRT2677724	hsa-miR-4671-3p	CLIP-seq
MIRT2427190	hsa-miR-4672	CLIP-seq
MIRT875512	hsa-miR-4676-5p	CLIP-seq
MIRT2499597	hsa-miR-4685-3p	CLIP-seq
MIRT2427191	hsa-miR-4685-5p	CLIP-seq
MIRT2499598	hsa-miR-4687-3p	CLIP-seq
MIRT2499600	hsa-miR-4694-3p	CLIP-seq
MIRT2499601	hsa-miR-4699-5p	CLIP-seq
MIRT1959565	hsa-miR-4701-3p	CLIP-seq
MIRT2499602	hsa-miR-4709-3p	CLIP-seq
MIRT875515	hsa-miR-4712-5p	CLIP-seq
MIRT1959566	hsa-miR-4713-5p	CLIP-seq
MIRT2499603	hsa-miR-4716-5p	CLIP-seq
MIRT2499604	hsa-miR-4723-3p	CLIP-seq
MIRT2427192	hsa-miR-4731-3p	CLIP-seq
MIRT2499606	hsa-miR-4735-5p	CLIP-seq
MIRT2499607	hsa-miR-4738-3p	CLIP-seq
MIRT2677725	hsa-miR-4740-5p	CLIP-seq
MIRT1959569	hsa-miR-4766-5p	CLIP-seq
MIRT875519	hsa-miR-4768-3p	CLIP-seq
MIRT2499608	hsa-miR-4774-3p	CLIP-seq
MIRT2499609	hsa-miR-4776-5p	CLIP-seq
MIRT2499610	hsa-miR-4777-5p	CLIP-seq
MIRT2499611	hsa-miR-4778-3p	CLIP-seq
MIRT2499612	hsa-miR-4781-3p	CLIP-seq
MIRT2427193	hsa-miR-4790-3p	CLIP-seq
MIRT875463	hsa-miR-4795-3p	CLIP-seq
MIRT875522	hsa-miR-4795-5p	CLIP-seq
MIRT2427194	hsa-miR-4801	CLIP-seq
MIRT2427195	hsa-miR-4803	CLIP-seq
MIRT2499613	hsa-miR-485-5p	CLIP-seq
MIRT2499614	hsa-miR-489	CLIP-seq
MIRT875523	hsa-miR-491-5p	CLIP-seq
MIRT2499615	hsa-miR-492	CLIP-seq
MIRT2427196	hsa-miR-494	CLIP-seq
MIRT2499616	hsa-miR-495	CLIP-seq
MIRT875464	hsa-miR-498	CLIP-seq
MIRT2499617	hsa-miR-506	CLIP-seq
MIRT2499618	hsa-miR-512-3p	CLIP-seq
MIRT1959571	hsa-miR-513a-3p	CLIP-seq
MIRT875525	hsa-miR-513a-5p	CLIP-seq
MIRT2499619	hsa-miR-518d-5p	CLIP-seq
MIRT2499620	hsa-miR-519b-5p	CLIP-seq
MIRT2499621	hsa-miR-519c-5p	CLIP-seq
MIRT2499622	hsa-miR-520a-5p	CLIP-seq
MIRT2499623	hsa-miR-520c-5p	CLIP-seq
MIRT2499624	hsa-miR-520d-5p	CLIP-seq
MIRT2499625	hsa-miR-524-5p	CLIP-seq
MIRT2499626	hsa-miR-525-5p	CLIP-seq
MIRT2499627	hsa-miR-526a	CLIP-seq
MIRT1959572	hsa-miR-532-3p	CLIP-seq
MIRT2499628	hsa-miR-544	CLIP-seq
MIRT2427199	hsa-miR-548a-5p	CLIP-seq
MIRT2427200	hsa-miR-548ab	CLIP-seq
MIRT2427201	hsa-miR-548ak	CLIP-seq
MIRT2499629	hsa-miR-548an	CLIP-seq
MIRT2427202	hsa-miR-548b-5p	CLIP-seq
MIRT2499630	hsa-miR-548c-3p	CLIP-seq
MIRT2427203	hsa-miR-548c-5p	CLIP-seq
MIRT2427204	hsa-miR-548d-5p	CLIP-seq
MIRT2427205	hsa-miR-548h	CLIP-seq
MIRT2427206	hsa-miR-548i	CLIP-seq
MIRT2427207	hsa-miR-548j	CLIP-seq
MIRT2427208	hsa-miR-548m	CLIP-seq
MIRT2499631	hsa-miR-548q	CLIP-seq
MIRT2499632	hsa-miR-548s	CLIP-seq
MIRT2427210	hsa-miR-548w	CLIP-seq
MIRT2427211	hsa-miR-548y	CLIP-seq
MIRT2499633	hsa-miR-550a	CLIP-seq
MIRT2427212	hsa-miR-559	CLIP-seq
MIRT2427213	hsa-miR-570	CLIP-seq
MIRT875527	hsa-miR-573	CLIP-seq
MIRT875528	hsa-miR-575	CLIP-seq
MIRT2499634	hsa-miR-576-3p	CLIP-seq
MIRT1959574	hsa-miR-577	CLIP-seq
MIRT2499635	hsa-miR-579	CLIP-seq
MIRT2499636	hsa-miR-583	CLIP-seq
MIRT2499637	hsa-miR-587	CLIP-seq
MIRT2499638	hsa-miR-591	CLIP-seq
MIRT2499639	hsa-miR-595	CLIP-seq
MIRT2427214	hsa-miR-607	CLIP-seq
MIRT1959575	hsa-miR-609	CLIP-seq
MIRT1959577	hsa-miR-628-5p	CLIP-seq
MIRT2427216	hsa-miR-629	CLIP-seq
MIRT875469	hsa-miR-640	CLIP-seq
MIRT2427217	hsa-miR-641	CLIP-seq
MIRT2499640	hsa-miR-643	CLIP-seq
MIRT2499641	hsa-miR-653	CLIP-seq
MIRT2499643	hsa-miR-676	CLIP-seq
MIRT2499644	hsa-miR-708	CLIP-seq
MIRT2499645	hsa-miR-711	CLIP-seq
MIRT875530	hsa-miR-770-5p	CLIP-seq
MIRT875531	hsa-miR-877	CLIP-seq
MIRT2427220	hsa-miR-889	CLIP-seq
MIRT2499646	hsa-miR-935	CLIP-seq
MIRT2427221	hsa-miR-936	CLIP-seq
MIRT2499647	hsa-miR-942	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CTNNB1	Unknown	17724465
HDAC1	Repression	18372343
HMGA1	Activation	15901130
IKBKB	Repression	18600306
MYCN	Activation	19885598
SMARCA1	Repression	14604992
SMARCA4	Repression	14604992
SMARCB1	Repression	14604992
SNAI2	Activation	20509143
SP1	Activation	12972613
TCF4	Unknown	16311123
TWIST1	Activation	17487558
TWIST2	Activation	17487558

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IBA
GO:0004896	Function	Cytokine receptor activity	IBA
GO:0004896	Function	Cytokine receptor activity	IDA	17045821
GO:0005515	Function	Protein binding	IPI	11207560, 20962267, 21397861, 23855374, 29190904
GO:0005518	Function	Collagen binding	NAS	2471973
GO:0005540	Function	Hyaluronic acid binding	IBA
GO:0005540	Function	Hyaluronic acid binding	IDA	17170110, 17324121
GO:0005540	Function	Hyaluronic acid binding	IEA
GO:0005540	Function	Hyaluronic acid binding	NAS	1991450
GO:0005576	Component	Extracellular region	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	20962267
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	1991450
GO:0005886	Component	Plasma membrane	TAS
GO:0005902	Component	Microvillus	IEA
GO:0005902	Component	Microvillus	ISS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006954	Process	Inflammatory response	IBA
GO:0007155	Process	Cell adhesion	IBA
GO:0007155	Process	Cell adhesion	IDA	19703720
GO:0007155	Process	Cell adhesion	IEA
GO:0007160	Process	Cell-matrix adhesion	NAS	1922057
GO:0009653	Process	Anatomical structure morphogenesis	IEA
GO:0009986	Component	Cell surface	IDA	16809613, 17170110
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IBA
GO:0016324	Component	Apical plasma membrane	IDA	20962267
GO:0016477	Process	Cell migration	IDA	22726066
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0030214	Process	Hyaluronan catabolic process	IDA	17170110
GO:0030667	Component	Secretory granule membrane	TAS
GO:0031258	Component	Lamellipodium membrane	IDA	20962267
GO:0032991	Component	Protein-containing complex	IEA
GO:0034116	Process	Positive regulation of heterotypic cell-cell adhesion	IMP	15100360
GO:0035692	Component	Macrophage migration inhibitory factor receptor complex	IBA
GO:0035692	Component	Macrophage migration inhibitory factor receptor complex	IDA	17045821
GO:0042110	Process	T cell activation	IDA	7528188
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0042995	Component	Cell projection	IDA	20962267
GO:0042995	Component	Cell projection	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	19047049
GO:0043518	Process	Negative regulation of DNA damage response, signal transduction by p53 class mediator	IDA	17045821
GO:0044319	Process	Wound healing, spreading of cells	IMP	20962267
GO:0044344	Process	Cellular response to fibroblast growth factor stimulus	IDA	19577615
GO:0048731	Process	System development	IEA
GO:0051216	Process	Cartilage development	IEP	11944887
GO:0070062	Component	Extracellular exosome	HDA	19199708, 20458337, 23533145
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IBA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	17045821
GO:0070487	Process	Monocyte aggregation	IMP	15100360
GO:0098609	Process	Cell-cell adhesion	NAS	1922057
GO:1900625	Process	Positive regulation of monocyte aggregation	IMP	20522558
GO:1902166	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IDA	17045821
GO:2000392	Process	Regulation of lamellipodium morphogenesis	IMP	20962267

Other IDs

• MIM: 107269
• HGNC: 1681
• e!Ensembl: ENSG00000026508

Protein

• UniProt ID: P16070
• Protein name: CD44 antigen (CDw44) (Epican) (Extracellular matrix receptor III) (ECMR-III) (GP90 lymphocyte homing/adhesion receptor) (HUTCH-I) (Heparan sulfate proteoglycan) (Hermes antigen) (Hyaluronate receptor) (Phagocytic glycoprotein 1) (PGP-1) (Phagocytic glycop
• Protein function: Cell-surface receptor that plays a role in cell-cell interactions, cell adhesion and migration, helping them to sense and respond to changes in the tissue microenvironment (PubMed:16541107, PubMed:19703720, PubMed:22726066). Participates thereby
• PDB: 1POZ, 1UUH, 2I83, 4PZ3, 4PZ4, 6TXS
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00193	Xlink	32 → 119	Extracellular link domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in fibroblasts and urine (at protein level) (PubMed:25326458, PubMed:36213313, PubMed:37453717). Detected in placenta (at protein level) (PubMed:32337544). Isoform 10 (epithelial isoform) is expressed by cells of epithelium an
• Sequence:

  MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTL
  PTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFN
  ASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSS
  GSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATTLMSTSATATETATKRQE
  TWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWEPNEENEDERDRHLSFSGSGIDDD
  EDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWN
  PEAHPPLIHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDS
  HSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSIT
  LQPTANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDV
  TGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNR
  SLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLAL
  ALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASKSQEMVHLVNKESSET
  PDQFMTADETRNLQNVDMKIGV

• Sequence length: 742

Pathways

KEGG:

ECM-receptor interaction
Hematopoietic cell lineage
Shigellosis
Epstein-Barr virus infection
Proteoglycans in cancer
MicroRNAs in cancer

Reactome:

Degradation of the extracellular matrix
Cell surface interactions at the vascular wall
Integrin cell surface interactions
Hyaluronan uptake and degradation
Neutrophil degranulation
Interferon gamma signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Blood group, Indian system	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CD44-related disorder	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS, HEREDITARY NONPOLYPOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONTACT DERMATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, CONTACT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATOLOGIC DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INDIAN BLOOD GROUP SYSTEM POLYMORPHISM	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, PROMYELOCYTIC, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYNCH SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrolithiasis, calcium oxalate	association	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
NEUROBLASTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES, GENETIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acoustic Neuroma	Acoustic Neuroma	BEFREE	8651925		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	16636662		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	LHGDN	16636662		★☆☆☆☆ Found in Text Mining only
Acute Kidney Insufficiency	Acute Kidney Insufficiency	CTD_human_DG	23052191		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	12941810, 16998483, 18005092, 1833412, 18398738, 23263849, 28395118, 28569787, 30430079		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	LHGDN	17914409		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	21993315		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	23098472		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	23098472		★☆☆☆☆ Found in Text Mining only
Acute otitis media	Otitis media	BEFREE	31226944		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	CTD_human_DG	16208414, 17349212		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	LHGDN	18094716		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	23098472		★☆☆☆☆ Found in Text Mining only
Adamantinous Craniopharyngioma	Adamantinous Craniopharyngioma	BEFREE	24356780		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10750777, 11180088, 11496303, 12399124, 16193174, 21124918, 24549646, 25335738, 25347154, 25625240, 28216140, 31230819, 7513991, 7531611, 7537174, 8566581, 8599448, 8608952, 8628718, 8905400		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of ampulla of Vater	Adenocarcinoma	BEFREE	26572077		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	11149422, 23007737, 25220787, 27062566, 30021598, 31181310		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of duodenum	Adenocarcinoma Of Duodenum	BEFREE	26517627		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	16425351, 23151220, 9609756		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	12399124, 12816733, 20937222, 23208496, 24363164, 27806326, 28819374, 29537891, 29803834, 30798450, 30908413		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	25797268, 7537174, 9816340		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	8839552, 9815753		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	10993271, 31273546		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	10027409, 19246453, 19787202, 22562538, 26990997, 27821646, 28255344, 28716720, 7513984, 7534253, 9592182		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	10027409, 12782013, 19787202, 28255344, 7513984, 8566581, 8608952, 9893637		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	10027409		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	CTD_human_DG	28255344		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	8416989, 8566581, 8695347		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Neoplasms	Adrenal neoplasia	BEFREE	19131502		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	15167935		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	25278703		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	12941810, 18005092, 28569787		★☆☆☆☆ Found in Text Mining only
Adult Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	12730955		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	8920885		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	21804080		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	27550999		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	22710270, 32066474, 34556089, 37848007, 37866628, 38554950	Associate	★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	12189507, 29971493		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	11180088, 8573713, 8985742, 9436970		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	24727741		★☆☆☆☆ Found in Text Mining only
Anemia Dyserythropoietic Congenital	Congenital dyserythropoietic anemia	Pubtator	27784127	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	25797268, 26880805, 27283965, 27789528, 27893718, 28064441, 28421110, 28507327, 30348713, 30655325		★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	28659655	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	15509527, 31885343	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	LHGDN	15509527		★☆☆☆☆ Found in Text Mining only
Aortic valve calcification	Aortic valve calcification	BEFREE	30951363		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	27550999		★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	Pubtator	31845023, 39252332	Associate	★☆☆☆☆ Found in Text Mining only
Arsenic Encephalopathy	Arsenic Encephalopathy	CTD_human_DG	16835338		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	14593587, 16620830, 20382854, 25115202, 29750899, 29792915, 29803939, 30480520, 31846890		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	16849507, 25708025		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	LHGDN	17911438		★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	9209678	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Reactive	Reactive arthritis	Pubtator	10531076	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11106576, 12209509, 12697740, 20203421, 25853812, 9042434, 9922986	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	12210602	Inhibit	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	20559002, 27598620		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	21570715, 26998837, 30426778, 31430856	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	10936787, 12767055, 29914429, 32146793, 33030522	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	11113870, 15981099, 2233756, 8599448, 9436970		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	14593587, 16620830, 20382854, 25115202, 29750899, 29792915, 29803939, 30480520, 31846890		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	15509527, 16620830		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	20382854, 34329656	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	28871329, 31419440		★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	37530333	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10378517, 15053229, 16849507, 18025246, 22456539, 29625181, 9756727		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	10674028, 9739051	Associate	★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	BEFREE	16730882		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	11591117, 24651014, 25964560		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	12009784, 28216140		★☆☆☆☆ Found in Text Mining only
Behavioral tic	Tourette syndrome	BEFREE	27789528, 28052035		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	9187133		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	15289848, 28083789, 9815753		★☆☆☆☆ Found in Text Mining only
Beta ketothiolase deficiency	Beta-ketothiolase deficiency	Pubtator	26572077	Stimulate	★☆☆☆☆ Found in Text Mining only
Bile duct carcinoma	Bile duct carcinoma	BEFREE	7537711		★☆☆☆☆ Found in Text Mining only
Bile Duct Neoplasms	Bile duct neoplasms	Pubtator	23480770	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasm	Biliary Tract Neoplasm	LHGDN	18214619		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	14981907, 18804101, 19666525, 20960509, 24069434, 25551284, 27599396, 28213097, 28607587, 29674052, 29725414, 30128900, 30635654, 30650148, 30719824, 31222373, 31529191, 31718471, 7472774, 8148709, 8749947		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	18199543, 18608209, 18804101		★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	16761672	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	16331882, 37040171	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	27530814	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	1537623, 24302539, 29218080, 31147008, 7536236, 8651925, 8750184, 8750190, 8750191, 9833394		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	29693014, 7541233	Associate	★☆☆☆☆ Found in Text Mining only
Brain Tumor, Primary	Brain Neoplasms	BEFREE	11136998, 7536236, 8651925, 8750184, 8750191		★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	18559090, 23813303		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10326795, 10470143, 11496303, 12748184, 12786890, 15069551, 15943035, 15943793, 16125700, 16464948, 16651431, 16691370, 16778178, 17344212, 17651715, 17692113, 17709176, 18193036, 18394172, 18559090, 19149630, 19350388, 19402080, 19528475, 19826050, 19895368, 19906290, 19957272, 19997106, 20019840, 20074564, 20405247, 20470755, 20509143, 20530438, 20569497, 20890129, 20971068, 21187973, 21196304, 21199873, 21266162, 21371176, 21388061, 21393860, 21394007, 21573501, 21717460, 21804359, 21833471, 21835433, 21874052, 21884643, 21904396, 21913222, 21915302, 21957977, 21970856, 22023707, 22031535, 22037257, 22086602, 22110198, 22113945, 22119938, 22127234, 22152097, 22386367, 22621373, 22692575, 22771536, 22788972, 22922740, 22992620, 23012411, 23039365, 23091114, 23226410, 23326564, 23484019, 23500524, 23748175, 23764310, 23801032, 23813303, 23851504, 23900701, 23940692, 24008095, 24009708, 24075827, 24297508, 24386318, 24395108, 24409301, 24512624, 24586375, 24606718, 24715151, 24840202, 24990559, 25081531, 25269647, 25269750, 25339657, 25377473, 25683728, 25815697, 25888636, 25909162, 25971596, 26079538, 26151392, 26201092, 26299192, 26384399, 26474458, 26687806, 26869223, 27121210, 27133070, 27178239, 27220365, 27259689, 27470135, 27499099, 27683033, 27779682, 27816361, 27885422, 28096667, 28123641, 28137613, 28255366, 28300837, 28393427, 28481500, 28659634, 28744156, 28746471, 28915803, 28937653, 29062075, 29190904, 29298343, 29318879, 29321661, 29483847, 29693159, 29729523, 29748526, 29777742, 29845398, 29963269, 29976229, 30023561, 30091683, 30233206, 30254460, 30298719, 30318226, 30361447, 30362671, 30364293, 30405844, 30443182, 30465921, 30562512, 30613295, 30628646, 30691317, 30692202, 30699364, 30707960, 30860617, 30880222, 31047143, 31075227, 31125725, 31228326, 31352658, 31409851, 31417182, 31496817, 31541685, 31571501, 31579408, 31612865, 31762938, 31806729, 7488429, 7529235, 7534855, 7585612, 8654608, 8749947, 8781700, 8871537, 9130462, 9131272, 9266106, 9291436, 9600122, 9665479, 9833394, 9872731, 9887098		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10567878, 11488992, 11839564, 15632176, 16286510, 16524453, 17229949, 17392272, 18376796, 18404683, 18438684, 18559090, 18729497, 19047049, 19048252, 19385591, 19435916, 19488035, 19522481, 19633292, 19666588, 19794958, 19799609, 19899128, 20043317, 20103682, 20126581, 20199686, 20228222, 20491779, 20509143, 20525204, 20530438, 20665103, 20691079, 20696077, 20810282, 20835647, 20843787, 21070402, 21187973, 21196304, 21334874, 21559013, 21718681, 21804359, 21824412, 21935375, 21957977, 22014860, 22198296, 22241087, 22331423, 22621373, 22762532, 22772984, 22788972, 22791584, 22934887, 22937154, 23028444, 23039365, 23046710, 23320416, 23764310, 23813303, 23883436, 23888049, 23940692, 23955388, 24039897, 24167614, 24186075, 24276281, 24409301, 24512624, 24583601, 24586375, 24606718, 24614402, 24675467, 25184276, 25306216, 25343626, 25408372, 25445919, 25571897, 25573951, 25579546, 25804234, 25978366, 26005723, 26080397, 26091795, 26447611, 26474458, 26482896, 26563370, 26938523, 27115469, 27178239, 27253518, 27654639, 27768764, 27837613, 28084338, 28112378, 28173833, 28264026, 28302531, 28398698, 28399903, 28523716, 28667313, 28716088, 28746471, 28791489, 29121955, 29145336, 29178343, 29356399, 29606612, 29748526, 30091683, 30179299, 30327566, 30362671, 30377878, 30873742, 31331331, 31450925, 31545416, 31968657, 32316333, 32428448, 32986353, 33024087, 33050539, 33274565, 33296812, 33342788, 33390842, 33427725, 33649828, 33919234, 34073849, 34087833, 34209696, 34932597, 35068436, 35577044, 35690642, 35879327, 35937944, 36100762, 36654075, 36946266, 37040171, 37466609, 37530329, 37898858, 38172135, 40430044, 40587726, 7538103, 8362982, 8749947, 8909242, 9600122	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16254109	Inhibit	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	25449221		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	11389007, 20920234	Inhibit	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	11591117, 20920234, 7590880, 9058839		★☆☆☆☆ Found in Text Mining only
Cachexia	Cachexia	Pubtator	27879288	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	24927072		★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	21194677	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	10898120, 11073815, 21117172, 21149267, 21829201, 23480770, 23510689, 24699672, 33334821, 36631756, 38126564, 7513984, 7534253, 7590880	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	23444222, 31804333	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10027409, 10037277, 10439835, 10699925, 10873090, 11263866, 11554165, 11606498, 12469144, 12474536, 17487380, 18092951, 19787202, 1991450, 20374021, 22242150, 23208496, 23266770, 25374189, 28215944, 28414310, 28507278, 29321661, 31738017, 7520354, 7534253, 7536236, 7538103, 7545538, 7574907, 8416989, 8573713, 8579108, 8608952, 8655705, 8780391, 8959559, 9242440, 9291438, 9390037, 9492843, 9772282, 9788739, 9839501, 9893637		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	16080532, 28499650, 31977320, 36363571, 7505117	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	11896210, 18559090, 24505115, 33845831, 35501667, 36374143	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	17239264, 20835647, 22762532, 24512624, 25889325, 30362671	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	18376796, 21824412, 26617852, 9665479	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	25129125, 28990139	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	18997126, 20511115, 21055388, 22673507, 22713659, 23031740, 23232273, 24300972, 24614035, 24966965, 24971320, 25542265, 26176896, 26540347, 27874296, 28442344, 29377347, 29515105, 29669827, 30636370, 31127852, 31223284, 31301090, 31360109, 31698617, 31903159, 31989649, 32168951, 32705218, 33062675, 33199679, 34028567, 34328657, 35887129, 35958556, 36192574, 36735564, 37715221	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	27584160	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	35266015	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of uterine cervix	Cervical Intraepithelial Neoplasia	BEFREE	9152428		★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	20835647, 24512624, 27247112	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	17239264	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	23813303	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	26821610, 28262804, 29900918, 33073679	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of ampulla of Vater	Ampullary Carcinoma	BEFREE	10547541		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	10873090, 18804101, 19666525, 20960509, 24069434, 25551284, 27599396, 28213097, 28607587, 29674052, 29725414, 30128900, 30635654, 30650148, 30719824, 31222373, 31529191, 31718471, 7472774, 8148709, 8749947		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	27460703, 29307338		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11054026, 11581176, 16425351, 20596057, 21124918, 23208496, 23469181, 23683495, 24019906, 24091605, 25335738, 25955300, 26686386, 26724540, 27500490, 28259998, 28446126, 28460475, 29148014, 29691367, 30049789, 30365189, 9846498		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	16461565, 19603017, 23468946, 27894167, 36580004	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	21411814, 24839953, 25542265, 27283965, 27414409, 28659655, 30942874, 33836674	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	11063642, 15578803, 15999156, 17284111, 22951174, 25031744, 26918621, 26943029, 31950034, 33287763, 33836688, 34370716, 34934046, 35955933, 37189176, 8579108	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37563650	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	11054026	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	26832214	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	11054026, 16264381, 19596931, 19681903, 19900133, 2007624, 23143465, 23437366, 24019906, 24346092, 25335738, 25400809, 25847894, 27197582, 27584160, 28523303, 32859636, 35501667, 37148002, 38126564, 38406907	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	16998464	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28631562	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	10550296, 26662954	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	15783086	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	26391478, 8599448, 8682591, 9027631		★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	11263866		★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	LHGDN	18835619		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10053108, 10470114, 10628329, 11063638, 11115587, 20400975, 21541039, 22350800, 22498306, 23492823, 23565736, 23730209, 24036854, 24824928, 25515492, 25658794, 25687880, 25823654, 26250934, 26569327, 27253518, 27300001, 27894167, 28070170, 28123528, 28675028, 29130517, 29131012, 29537103, 29730663, 29890852, 29915283, 30115698, 31019941, 31147393, 31186752, 31497537, 31729966, 7543560, 8519665, 8669861, 9216637, 9494539, 9494551, 9815989		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	23241663, 29792915		★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	15380042, 30553836	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	19254252		★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	28854563	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	Pubtator	35778717	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	BEFREE	7793988		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	25310288, 7539775, 8682582, 9264567		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	10229774, 8751553		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	24604526, 25310288, 7539775, 7574907, 8682582, 9264567		★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth Disease	Charcot-Marie-Tooth Disease	BEFREE	19657941		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	12941810, 18005092, 18398738, 28569787		★☆☆☆☆ Found in Text Mining only
Childhood Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	12730955		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	20471664, 21833756, 27176078, 30402042		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	23192764, 23480770, 33498866, 35670491, 36469154, 37205633	Associate	★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	10674028, 12077104	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	11777908, 12183053, 18344598, 19179614, 19734846	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	12402308		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	15596224		★☆☆☆☆ Found in Text Mining only
Chronic colitis	Colitis	BEFREE	28031321		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	37108355	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10023342, 16321852, 22237050, 23547049, 29352038		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	30760334	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	38567731	Stimulate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	30689936		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	29243496, 31053527		★☆☆☆☆ Found in Text Mining only
Cleft Lip with or without Cleft Palate	Cleft Lip With Or Without Cleft Palate	BEFREE	20020508		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	35693826	Associate	★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	17382349, 28854563		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	37866628	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	29186109		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	20974992	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	21473743	Inhibit	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	32871953, 34837915	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10551329, 10699925, 11447138, 11751503, 12090473, 14534719, 15215046, 15231668, 16229833, 17599831, 17945212, 18375392, 19734943, 20433742, 21473743, 21640118, 22552741, 22923071, 23002207, 23800986, 24009708, 24145190, 25220787, 25625240, 26238079, 26840024, 27109343, 27323782, 27599396, 27600678, 27959393, 28373475, 29115557, 29486262, 29902507, 31578584, 7536236, 7538103, 7545538, 7577002, 8605724, 8858111, 8909242, 9316589		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	24619956, 8909242	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	10567875, 11169447, 11839564, 16565092, 1698783, 18234849, 19004834, 19437567, 2246274, 25400792, 27062566, 30021598, 34086943, 37098074, 9777953	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	14534719, 17599831, 17945212, 17945213		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	19652364, 20200161, 26091938, 29421551, 7591309, 9777953		★☆☆☆☆ Found in Text Mining only
Colonic Polyps	Colonic polyps	Pubtator	19010307, 34257584	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10755402, 11149422, 11194197, 11724345, 11745187, 11839557, 12215164, 12782013, 14966921, 17548814, 19277703, 19321126, 19787202, 20488884, 20606680, 21640118, 21764578, 22266115, 23151220, 23251004, 23300952, 23354547, 23404221, 23418321, 23571142, 23736004, 24009708, 24823486, 24921913, 24975268, 25550556, 25576211, 25625240, 26010608, 26747179, 26840024, 26974151, 26990997, 27260988, 28126685, 28360095, 28496335, 28499854, 28693269, 28716720, 28994324, 29029440, 29115557, 29343849, 29627827, 29845283, 30267881, 30275459, 30361904, 30456802, 30631039, 30742932, 30799951, 30813948, 30880758, 30899442, 30942083, 31114754, 31132784, 31360304, 31367190, 31485655, 31544978, 31682231, 7534253, 7538103, 7545538, 8416989, 8527042, 8566581, 8605724, 8608952, 8648366, 8655705, 8695347, 8763263, 9117309, 9489913, 9609756, 9658313, 9721884, 9772282, 9839501, 9849461, 9893637		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10471052, 10551329, 10711249, 10755402, 11073815, 11194197, 12515996, 12854146, 17579117, 18326857, 19734943, 20433742, 20606680, 20630067, 21070402, 22836803, 22895640, 24009080, 24023782, 24696849, 24720439, 24760019, 24864242, 25576211, 25665511, 25755763, 26010608, 26097606, 26283684, 26408312, 26747179, 26950675, 26974151, 26990997, 27062566, 27507615, 27764803, 28367998, 29105339, 29580161, 29886802, 30361904, 30658502, 30880758, 31469863, 31485655, 31619711, 31682231, 31754405, 31830379, 31989649, 32037723, 32115493, 32608200, 32647988, 32671503, 33334821, 33445526, 33893082, 34396431, 34753802, 35216292, 35590122, 35642021, 35670012, 35785618, 37074032, 37083591, 37098074, 37373014, 37452042, 37685852, 37849446, 38376276, 39312645, 39520192, 7534253, 7538103, 8416989, 8527042, 8655705, 8763262, 8763263, 8863664	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	11149422, 25625240, 7513991, 7534253, 8416989, 8562168, 9721884, 9777953		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	14669354, 15638368, 15641486, 16969488		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27983919	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28990068, 34837915	Stimulate	★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	21833756, 26455324		★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	28295742, 31600412		★☆☆☆☆ Found in Text Mining only
Congenital dyserythropoietic anemia	Congenital dyserythropoietic anemia	BEFREE	30876823, 7507739, 7521883		★☆☆☆☆ Found in Text Mining only
Congenital dyserythropoietic anemia, type II	Congenital dyserythropoietic anemia	BEFREE	27784127		★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of lung	Pulmonary hypoplasia	BEFREE	31269833		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	23374111		★☆☆☆☆ Found in Text Mining only
Conn Syndrome	Conn Syndrome	BEFREE	21330483		★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	CTD_human_DG	25724174		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	17607380, 24866595, 26850779, 28846080, 29243496, 30872677, 31053527, 7521786, 7591962, 8958311		★☆☆☆☆ Found in Text Mining only
Corneal Diseases	Corneal disease	Pubtator	9135415	Associate	★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal neovascularization	Pubtator	25551284	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	16620830		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	16620830		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	37706320	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	16620830		★☆☆☆☆ Found in Text Mining only
Coronary Thrombosis	Coronary Thrombosis	BEFREE	12377743		★☆☆☆☆ Found in Text Mining only
Costello Syndrome	Costello syndrome	Pubtator	10712202	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	17479111		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	22128034	Stimulate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	37550393	Associate	★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	BEFREE	17161332		★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	30018080		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	7542641		★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	14641413	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	11439372, 20886647, 22218639, 24916930, 28274742, 28482921, 29196459, 30775942, 31624271		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	31939436	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	30045969		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	12605696, 33289509	Associate	★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	CTD_human_DG	16835338		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatologic disorders	Dermatologic Disorders	BEFREE	9740242		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatomyositis	Dermatomyositis	BEFREE	21804080		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15736104, 30362534, 31550181		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15736104, 30362534, 31550181		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	24301906	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	38567731	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	10586428	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	38567731	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	29415062		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10586428, 12708751, 22499789, 25952479, 25987249, 31550181		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	29207157, 35923621, 37038746, 38013385	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	10586428, 12708751, 15983219, 25531564		★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	38406907	Associate	★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	24727741		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	18162778, 19857547, 20093404, 20920234, 25589617		★☆☆☆☆ Found in Text Mining only
Diffuse panbronchiolitis	Diffuse panbronchiolitis	Pubtator	11737075	Associate	★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	29090670, 9665479		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	29090670		★☆☆☆☆ Found in Text Mining only
Ectrodactyly	Ectrodactyly	Pubtator	27923017	Associate	★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	19116330	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	11496303, 12911725, 14519645, 19737954, 25129125, 29734248, 30372483, 30594556, 31013093, 31035965, 7518345, 9566719, 9600123, 9614383, 9826458		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	11966474, 20374665, 25129125, 30372483, 39888143, 9600123	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	12911725		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	9647570		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	11966474, 19200980	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	17919613		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	19200980, 23653392, 25935136, 29229305, 29621955		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	33218351	Inhibit	★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	21921589	Inhibit	★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	28194801		★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	29704232, 31788082		★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Dystrophica	Dystrophic epidermolysis bullosa	Pubtator	2522973	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	20400975, 23565736, 26250934, 26569327, 27894167, 29131012, 29537103, 29890852, 29915283, 30115698, 31019941, 31729966, 7543560, 9494551		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	22770970, 24016461, 27599396, 8599448, 9721884		★☆☆☆☆ Found in Text Mining only
Esophageal Diseases	Esophageal Diseases	BEFREE	12009784		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	15726543, 17708612, 22069487, 23797812, 24083764, 25212506, 31671695, 40282339	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	10601048, 23797812, 25897987, 27422721, 28414310, 28927233, 36042592, 36609391, 39300946	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	23241663		★☆☆☆☆ Found in Text Mining only
Familial Intestinal Polyposis	Multiple polyposis syndrome	CTD_human_DG	28255344		★☆☆☆☆ Found in Text Mining only
Familial Testotoxicosis	Testotoxicosis	BEFREE	23861372		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	21138479		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	21138479		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	18952835, 28323124		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28323124, 30778201		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	10574596		★☆☆☆☆ Found in Text Mining only
Fibromyxosarcoma	Fibromyxosarcoma	BEFREE	31662543		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	10425558, 20428807, 9333016, 9634540		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	15998433		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	27998643, 28799058, 29276101, 30285525, 30799414, 31630546		★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	9589486		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	9589486		★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	29114039, 29375303		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	31619711	Associate	★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	9135415	Associate	★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	10767365, 11180088, 20948317, 24186075, 24725816, 28677740, 30288117		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	18497548, 24186075	Associate	★☆☆☆☆ Found in Text Mining only
Gallstones	Gallstones	Pubtator	24186075	Associate	★☆☆☆☆ Found in Text Mining only
Ganglioneuroblastoma	Ganglioneuroblastoma	BEFREE	9099963, 9256826		★☆☆☆☆ Found in Text Mining only
Ganglioneuroma	Ganglioneuroma	BEFREE	7518353, 7576948, 9256826		★☆☆☆☆ Found in Text Mining only
Gardner Syndrome	Gardner Syndrome	BEFREE	28214837		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	12820426, 21105049, 25212506, 27910777, 9592182		★☆☆☆☆ Found in Text Mining only
Gastrinoma	Gastrinoma	BEFREE	7508823		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	26639196, 31081048		★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	25658601		★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	35462765	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	16419149, 7545538		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	16419149, 30142697	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	LHGDN	17516109		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	22076958, 26243012, 29204252		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	22076958	Associate	★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	10879740	Associate	★☆☆☆☆ Found in Text Mining only
Genitourinary Cancer	Genitourinary Cancer	BEFREE	27044355		★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	9588883		★☆☆☆☆ Found in Text Mining only
Gestational trophoblastic disease	Hydatidiform mole	BEFREE	28365860		★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Neoplasms	Gestational Trophoblastic Neoplasms	BEFREE	28365860		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	Pubtator	25929323	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	1537623, 20150644, 20197461, 21156287, 22024282, 22493711, 23877317, 23993863, 24302539, 24526308, 25749043, 25750037, 27527869, 28036297, 28070830, 28241049, 28716909, 28945172, 29030990, 29463580, 29495404, 29622771, 30210550, 31352310, 31528214, 31746135, 31832018, 7536236, 9364462, 9436970		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	20235609	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	20383808, 22363471, 22493711, 23855374, 24075410, 24962319, 25749043, 27906173, 28365151, 28945172, 30467961, 31453379, 31746135, 31969757, 33003586, 33596115, 34301218, 35558067, 35682709	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	34066147	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	19468690, 19835469, 20150644, 20197461, 21156287, 22024282, 23877317, 23993863, 24302539, 24526308, 25749043, 25750037, 27527869, 28070830, 28241049, 28945172, 29030990, 29218080, 29463580, 29495404, 29622771, 30127875, 30210550, 30341039, 31352310, 31516582, 31528214, 31746135, 31832018, 7536236, 9436970		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10571407, 1537623, 15992376, 20197461, 23827186, 23855374, 23877317, 27807067, 28030801, 28052252, 28813675, 28929335, 29218080, 29463580, 29726297, 30210550, 31111534, 31506754, 31516582, 31528214, 8603821, 8750191, 8869148, 9364462		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	11716065		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	11839564, 15016831, 15992376, 18398462, 22363471, 22493711, 22906261, 24410805, 28445977, 32146793, 32484805, 32977522, 33030522, 33269813, 34170383, 34681583, 36348001, 36776876, 36835465, 37000153, 37101376, 37194413, 37481646, 37928523	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	21598246		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	28406696, 34861820, 37108355	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	27998643, 30362534		★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	36244796, 37108355, 37530333	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	24971320	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	35720300	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	40299971	Associate	★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	9172816		★☆☆☆☆ Found in Text Mining only
Hallopeau-Siemens Disease	DYSTROPHIC EPIDERMOLYSIS BULLOSA	BEFREE	20586780, 2522973		★☆☆☆☆ Found in Text Mining only
Harlequin Fetus	Harlequin Ichthyosis	BEFREE	24091605		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	15767360, 15823810, 17252589, 20227328, 22242150, 23627635, 24201869, 24475244, 26518895, 27002147, 28837080, 30210931, 30552846, 31593802		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	LHGDN	17627000		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	18396788, 22791367, 24475244, 25751671, 26666511, 27002147, 34655409, 35274800	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	22242150, 26540568	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	23374111		★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	24443441	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	10914548, 19857547, 21258793, 24680978, 24935458, 28958164, 29187870, 30018080, 9823960		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	24680978	Associate	★☆☆☆☆ Found in Text Mining only
Hepatic Fibrosis, Congenital	Congenital Hepatic Fibrosis	BEFREE	15998433		★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	12077104	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	9739051	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	33845831	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	22491449	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	30782931	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	22491449	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	25168019, 26535633		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	23748175, 28212584, 30246563, 30361903, 8909242	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	21471434		★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	CTD_human_DG	28255344		★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	28255344		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Pancreatitis	Pubtator	22895640	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary spherocytosis	Hereditary Spherocytosis	BEFREE	27784127		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	33683746	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	10209487, 7525912		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	18070985, 7579390, 8379348	Associate	★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	21887686, 8579108		★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform mole	Pubtator	15228429	Associate	★☆☆☆☆ Found in Text Mining only
Hydrops Fetalis	Hydrops Fetalis	BEFREE	29304545		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	10586428		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	29803939		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type III	Hyperlipoproteinemia	BEFREE	8175773		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	35586138	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	23241663, 30081869, 30897333		★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	20709728, 21087933, 30298719		★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	BEFREE	17161332		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	22216200, 23638097, 26323509, 26372732, 27038472, 30111297, 33533018, 34105295, 36093941	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	22937154, 26965643, 33288734, 37849446	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	9667649	Inhibit	★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	29433875, 30999901		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	21278261	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	32636398, 38252663	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	CTD_human_DG	25133636		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	21045192, 22001393		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	17548814, 18242515, 20019840, 23801032, 27655682, 30061637		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	33047155	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	10378517, 11447138, 7537840		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	37550393	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	28270211		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	30045969		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	27477082	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	22135720	Stimulate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	7537840		★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	9790096		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	11350606, 28982889		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	24512624, 30362671		★☆☆☆☆ Found in Text Mining only
Islet Cell Tumor	Islet Cell Tumor	BEFREE	7508823		★☆☆☆☆ Found in Text Mining only
Juvenile Pilocytic Astrocytoma	Astrocytoma	BEFREE	9436970		★☆☆☆☆ Found in Text Mining only
Kallmann Syndrome	Kallmann Syndrome	BEFREE	11983919		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	9243361		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	18032547, 37108355	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	33828170	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	CTD_human_DG	23052191		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	BEFREE	29773381		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Neoplasms	Kidney neoplasm	Pubtator	31855296, 33287763, 7591962, 9045950	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal neoplasm	Laryngeal neoplasm	LHGDN	18414895		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	15868954, 26756618, 29949786	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	29307338		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	29954254, 35118811	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10414233, 11994761, 16998483, 17657222, 21258793, 24684724, 25262448, 26708679, 27207438, 28395118, 28835099, 29187870, 30430079, 7692193, 7935981, 8957066		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11756184, 11994761, 15055269, 17349212, 20586634, 21806926, 27718302, 28569787, 31163672, 32697348, 33924032, 40362518, 8634437, 8920885	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	28216566	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	11756184, 14525786, 17349212, 23233446, 24375249, 27506934, 28965123, 29720577, 32697348, 34115113, 35289472, 36520954, 7579390	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	20586634	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	23098472	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10371506, 10414233, 10914548, 12700665, 14525786, 17349212, 17657222, 1833412, 20971508, 24038513, 25262448, 28489348, 28835099, 28965123, 31105032, 9558399		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	17657222		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	23098472		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	18162778, 8920885		★☆☆☆☆ Found in Text Mining only
LEUKOENCEPHALOPATHY, BRAIN CALCIFICATIONS, AND CYSTS	LEUKOENCEPHALOPATHY, BRAIN CALCIFICATIONS, AND CYSTS	BEFREE	23469181, 25335738		★☆☆☆☆ Found in Text Mining only
Li-Fraumeni Syndrome	Li-Fraumeni Syndrome	BEFREE	23031740		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	23422152, 24699672, 25640063, 29752852, 30409306		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11245045, 15205947, 18259754, 19826051, 20471664, 21055388, 21617840, 22673507, 22706704, 22713659, 23060277, 23238743, 23469181, 24300972, 24633918, 24647926, 24721996, 24971320, 25335738, 25572615, 25791790, 25797261, 26176896, 26256079, 27545991, 27925189, 27993894, 28411478, 28442344, 28693249, 29298343, 29377347, 29515105, 29649630, 29899840, 29906748, 29935166, 30064482, 30636370, 30938986, 31232474, 31294922, 31301090, 31511651, 31563690, 31698617, 31757938, 7537711, 7539239		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	18997126		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	29649630, 30689936, 31301090		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	31301090	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	10674028	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	31360109, 39805388	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	24104197	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	19713997, 22673507, 24721996, 30938986, 7539239		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	30177680	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	34363352	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	9316006		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	10607488	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	31509965	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	10898120, 11054026, 20454640, 23683495, 24019906, 24838270, 25335738, 27487131, 28446126, 32919536, 34407043, 35806135	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	11263866, 23947765, 24816422, 25335738, 26724540, 30365189, 30908413, 7509720		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12393872, 16533775		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	12215908, 21720246, 28257976, 9756727		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	11557652	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	17237445, 18025246, 20213807, 21194677, 21437871, 25890262, 28257976, 9739051	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	12215908, 21720246, 21804080, 28257976		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	12215908, 18025246, 20213807, 20738420, 21194677, 21720246, 25890262, 28257976, 31572382		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	17237445	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	20213807		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	12215908, 21720246, 28257976		★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	LHGDN	17975002		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	10326795, 15943035, 7574907		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	12841681, 12854146, 18376796, 18438684, 20530438, 21912471, 23046710, 23539643, 25169209, 25755763, 25889325, 26261555, 26408312, 26666511, 30021598, 31682231, 32434417, 34655409, 35435358, 36316684, 39412907	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20810282, 37098074	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	8731104	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	16998483, 30430079		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	10023342, 11994761, 7517210, 8347502, 8379348, 9740242	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10879740, 11007056, 11994761, 12533686, 18162778, 19787231, 20920234, 7525912, 7537255, 7538117, 8957066, 9058839		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	11792412		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	28854563	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	18804811	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	20920234	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	19787231, 20920234		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	10023342, 7537983, 9058839, 9243361		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	7537983, 9058839, 9243361		★☆☆☆☆ Found in Text Mining only
Lymphoma, Small Noncleaved-Cell	Lymphoma	BEFREE	1546685		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	9243361		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	19139084, 9363560		★☆☆☆☆ Found in Text Mining only
Lynch Syndrome	Lynch Syndrome	CTD_human_DG	28255344		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Glioma	Glioma	BEFREE	16132527, 18952589, 28030801, 9364462		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	15767360, 15823810, 17252589, 20227328, 22242150, 23627635, 24201869, 24475244, 26518895, 27002147, 28837080, 30210931, 30552846, 31593802		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	27773750, 28185919, 30061637		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	31147008		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10326795, 12748184, 15069551, 15943035, 16125700, 16464948, 16651431, 16691370, 16778178, 17651715, 17692113, 17709176, 18193036, 18394172, 18559090, 19149630, 19350388, 19402080, 19435916, 19528475, 19826050, 19895368, 19906290, 19957272, 19997106, 20019840, 20405247, 20470755, 20509143, 20530438, 20569497, 20890129, 20971068, 21187973, 21196304, 21199873, 21266162, 21371176, 21388061, 21393860, 21394007, 21573501, 21717460, 21804359, 21833471, 21835433, 21874052, 21884643, 21904396, 21913222, 21915302, 21957977, 21970856, 22023707, 22031535, 22037257, 22086602, 22110198, 22113945, 22119938, 22127234, 22152097, 22386367, 22621373, 22692575, 22771536, 22788972, 22922740, 23012411, 23039365, 23053657, 23091114, 23226410, 23326564, 23484019, 23500524, 23748175, 23764310, 23801032, 23813303, 23851504, 23900701, 23940692, 24008095, 24009708, 24075827, 24297508, 24386318, 24395108, 24409301, 24512624, 24586375, 24606718, 24715151, 24840202, 24990559, 25081531, 25269647, 25269750, 25339657, 25377473, 25683728, 25815697, 25888636, 25909162, 25971596, 26079538, 26151392, 26201092, 26299192, 26384399, 26474458, 26687806, 26869223, 27121210, 27133070, 27178239, 27220365, 27253518, 27259689, 27470135, 27499099, 27683033, 27779682, 27816361, 27885422, 28052035, 28096667, 28123641, 28255366, 28300837, 28393427, 28481500, 28659634, 28675028, 28744156, 28746471, 28915803, 28937653, 29062075, 29190904, 29298343, 29318879, 29321661, 29483847, 29693159, 29729523, 29748526, 29777742, 29845398, 29963269, 30023561, 30091683, 30197996, 30233206, 30254460, 30298719, 30361447, 30362671, 30364293, 30405844, 30443182, 30465921, 30562512, 30613295, 30628646, 30691317, 30692202, 30699364, 30707960, 30860617, 30880222, 31047143, 31075227, 31125725, 31228326, 31352658, 31496817, 31541685, 31571501, 31579408, 31612865, 31762938, 31806729, 7488429, 7529235, 7534855, 7585612, 8654608, 8749947, 8781700, 8871537, 9130462, 9131272, 9266106, 9291436, 9600122, 9833394, 9872731		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	11496303, 12911725, 14519645, 19737954, 25129125, 29734248, 30372483, 30594556, 31035965, 7518345, 9566719, 9826458		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	10767365, 24186075, 28677740, 30288117		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	24318997, 25576211, 30142697		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	12474536, 31534630, 7591962, 9045950		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	20837694, 27460703, 29307338		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	23031740, 23861222, 25094049, 26540347, 27650540, 27874296, 27959451, 28692045, 30083261, 30177680, 30399434, 30860617, 31127852, 31360109		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11054026, 11581176, 16425351, 20596057, 21124918, 23208496, 23469181, 23683495, 24019906, 24091605, 25335738, 25955300, 26686386, 26724540, 27500490, 28259998, 28446126, 28460475, 29148014, 29691367, 30049789, 30365189, 30908413, 31722999, 7509720, 9846498		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	23422152, 24699672, 25640063, 29752852, 30409306		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	24927072		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10053108, 10470114, 10628329, 11063638, 11115587, 19924647, 21541039, 22350800, 22498306, 23492823, 23565736, 23730209, 24036854, 24824928, 25515492, 25658794, 25687880, 25823654, 27253518, 27300001, 28070170, 28123528, 28427435, 28675028, 29130517, 29730663, 31186752, 31497537, 7543560, 8519665, 8669861, 9216637, 9494539, 9815989		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	12841682, 17446842, 19598259, 22322379, 22963768, 23036582, 23679813, 24132924, 24397969, 24719318, 24734907, 25566991, 25684468, 26077342, 26261555, 27893718, 28400334, 28507102, 28575959, 28659655, 28789349, 29106581, 29683068, 29750031, 30285798, 30348713, 30360026, 9737888, 9816340, 9849582		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	CTD_human_DG	17446842		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10344738, 10911909, 10950120, 11096236, 11223672, 11582589, 12576866, 12926045, 14517837, 15289848, 16158948, 16328056, 16886606, 18268494, 18539965, 20200161, 20370680, 20454608, 21138868, 21190562, 21282737, 21607288, 21953074, 22552290, 22870202, 23027394, 23166824, 23188675, 24549646, 24615685, 24659666, 24832177, 25216351, 25349289, 25483103, 25661993, 26624980, 27447749, 27893706, 28083789, 28256535, 28442344, 28758908, 28789597, 29029419, 29228713, 29358129, 29423071, 29682524, 29894706, 30112117, 30554119, 30633985, 30904606, 30930999, 31187175, 31315262, 31561211, 7510214, 7544357, 8628718, 9041184, 9575426, 9815753, 9935187		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	26391478, 8869105, 9027631		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11029494, 11066075, 16311123, 16440414, 20856229, 21105049, 21331451, 21471434, 22606006, 23179610, 23188090, 23900519, 24481453, 25009318, 25081334, 25212506, 25277524, 25479940, 26035691, 26119931, 26140900, 26416034, 26552644, 27107424, 27187279, 27323782, 27931044, 28123556, 28184940, 28186678, 28212584, 28326835, 28415792, 28428713, 28692437, 28694503, 29090670, 29445738, 29450424, 29845783, 29858680, 29862663, 30147339, 30165890, 30349314, 30543303, 31077346, 7520354, 7531611, 7676688, 7692200, 8636005, 8658214, 9390037, 9772282		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	21471434		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	24654752, 24727741, 30160089		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	18804101, 19666525, 20960509, 24069434, 25551284, 27599396, 28213097, 28607587, 29674052, 29725414, 30128900, 30635654, 30650148, 30719824, 31222373, 31529191, 31718471, 7472774, 8148709, 8749947		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10023342, 10037277, 10209487, 10229774, 10398281, 10470114, 10553022, 10589769, 10917171, 11007056, 11096236, 11115587, 11194197, 11223672, 11447138, 11496303, 11501843, 11676857, 11832714, 11978005, 12576866, 12711360, 12926045, 1357452, 14562280, 14758731, 14966921, 15215046, 15263805, 15311055, 15661232, 15701601, 15753387, 15783086, 16061646, 16125700, 16354706, 16425351, 16868940, 17210912, 17416541, 17592251, 17599831, 17679465, 17721886, 18092951, 18268494, 18690645, 18804811, 18952589, 1919439, 19360323, 19435919, 19578743, 19795205, 19826050, 19860843, 20093404, 20127360, 20197461, 20332234, 20370680, 20691079, 20737421, 20802512, 20861165, 20950370, 20962267, 20971068, 21087933, 21092249, 21105049, 21124918, 21132262, 21188630, 21266853, 21331451, 21363911, 21392411, 21397861, 21692061, 21804359, 21835433, 21953074, 21957977, 21963846, 22005013, 22037257, 22076958, 22242150, 22266115, 22271686, 22293754, 22328825, 22386367, 22433859, 22552741, 22621669, 22692575, 22706704, 22740085, 22771536, 22788972, 22870202, 22923071, 22930170, 23031740, 23047602, 23086478, 23208501, 23255607, 23265944, 23314380, 23374281, 23404221, 23426175, 23437366, 23492823, 23565736, 23600676, 23627635, 23633482, 23679813, 23730209, 23813303, 23877317, 23955388, 23968856, 23970349, 23974104, 24016461, 24019906, 24036854, 24132924, 24186075, 24297371, 24318997, 24337682, 24363164, 24386318, 24391839, 24395108, 24395741, 24403253, 24498388, 24549646, 24586375, 24727892, 24816422, 24823486, 24824928, 24835590, 24916930, 24921913, 24927072, 24947926, 25025570, 25081334, 25123505, 25129125, 25168019, 25268088, 25278704, 25279549, 25327563, 25335738, 25374189, 25461272, 25471937, 25472903, 25483103, 25526925, 25550556, 25605020, 25625240, 25640063, 25665511, 25750037, 25751671, 25762343, 25795715, 25909162, 25979842, 26010608, 26058661, 26098778, 26136504, 26253173, 26261555, 26278043, 26294655, 26312765, 26340918, 26372732, 26391478, 26399460, 26405196, 26453158, 26455324, 26517627, 26540347, 26569327, 26572077, 26662954, 26676867, 26708679, 26744529, 26880805, 26901847, 26926234, 27041584, 27044355, 27045798, 27070574, 27157616, 27176078, 27248169, 27253518, 27320862, 27323393, 27411517, 27463372, 27490763, 27499099, 27507056, 27521214, 27550999, 27569455, 27599396, 27630154, 27655682, 27738347, 27746021, 27746219, 27769048, 27773750, 27789195, 27819680, 27856246, 27886571, 27903969, 27931044, 27989859, 27990775, 28000766, 28017836, 28035370, 28036386, 28070170, 28121626, 28123556, 28153764, 28166194, 28215944, 28216300, 28223538, 28259998, 28262804, 28270211, 28276309, 28300837, 28326306, 28337375, 28373475, 28393186, 28403901, 28414310, 28415792, 28423035, 28523716, 28565875, 28575959, 28588718, 28607587, 28618017, 28620808, 28621523, 28631562, 28659634, 28660943, 28667792, 28731185, 28744156, 28749462, 28758908, 28789457, 28819374, 28837080, 28862656, 28875691, 28927233, 28929335, 28945333, 28952294, 28986884, 29062075, 29062810, 29069721, 29076344, 29082766, 29107218, 29113223, 29121598, 29162741, 29196508, 29200002, 29216821, 29218080, 29243496, 29245982, 29272095, 29277682, 29277789, 29284258, 29306324, 29307338, 29314711, 29321622, 29350904, 29354263, 29356399, 29385995, 29394261, 29433875, 29434323, 29435053, 29445738, 29450424, 29463580, 29476980, 29511206, 29537891, 29552200, 29599911, 29636610, 29674746, 29683262, 29721049, 29729523, 29731973, 29734248, 29747682, 29760516, 29761897, 29777858, 29779037, 29791975, 29805672, 29845398, 29845783, 29858680, 29888653, 29898364, 29915283, 29963269, 29972336, 29983670, 30002278, 30018080, 30023561, 30051427, 30061637, 30076764, 30093560, 30128900, 30177680, 30207200, 30211160, 30288117, 30352311, 30360026, 30387013, 30396933, 30402042, 30408413, 30474922, 30498096, 30504405, 30548174, 30582228, 30610551, 30613295, 30626605, 30628666, 30631039, 30636370, 30692202, 30709928, 30719824, 30787175, 30787326, 30788285, 30798450, 30799951, 30818864, 30860617, 30866863, 30895943, 30908865, 30942083, 30955861, 30965636, 30967592, 30982499, 31000523, 31013093, 31047143, 31049070, 31073886, 31077346, 31090215, 31106493, 31127852, 31132784, 31207547, 31312365, 31335117, 31358779, 31362044, 31394112, 31409851, 31444923, 31462709, 31474154, 31489619, 31506754, 31541681, 31544978, 31560739, 31620357, 31630417, 31654718, 31662543, 31672764, 31682231, 31685444, 31705880, 31717306, 31726709, 31742606, 31754405, 31757938, 31763810, 31781712, 31806995, 31834485, 7472774, 7488429, 7509720, 7518345, 7533658, 7539775, 8148709, 8320265, 8519665, 8608952, 8669861, 8674003, 8909242, 8985743, 9216637, 9239683, 9242440, 9264567, 9316589, 9494551, 9849461, 9864432, 9893744		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	12730955, 14730703		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	25310288, 7539775, 8682582, 9264567		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10551329, 11447138, 14534719, 15215046, 16229833, 17599831, 17945212, 19734943, 20433742, 20664940, 21640118, 22552741, 22923071, 23002207, 23800986, 24009708, 24145190, 25220787, 25625240, 26238079, 26840024, 27109343, 27323782, 27599396, 27600678, 27959393, 28373475, 29115557, 29486262, 31578584, 7577002, 8605724, 8909242		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	BEFREE	7585612, 8573713		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11982338, 12748184, 12779084, 15090545, 17651715, 18404683, 18559090, 19435916, 19799609, 19895368, 19899128, 20484027, 20843787, 21187973, 21393860, 21633165, 21957977, 22031535, 22152097, 22237177, 22621373, 23341935, 23955388, 25306216, 25888636, 26387546, 27220365, 27499099, 28393427, 29190904, 29729523, 29771420, 30443182, 30662326, 31532629, 7534855, 9130462		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12145287, 15943035, 16234326, 17540049, 18227732, 18350162, 18559090, 19176383		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	20920234		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	BEFREE	16820603		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	30018080		★☆☆☆☆ Found in Text Mining only
Mastocytosis, Systemic	Mastocytosis	BEFREE	30018080		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	39963032	Associate	★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	31741714		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11423990, 12702150, 12883358, 15292257, 16631740, 1742741, 19865098, 21136024, 23342032, 23560496, 25897340, 26391478, 27041584, 28759238, 29296081, 29309357, 30297743, 30832692, 31741714, 7542641, 8640067, 8805300, 9027631		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	12574156, 15292257, 18971959, 19434087, 19696445, 19865098, 21078678, 22072879, 25138157, 25169209, 25447529, 26391478, 28264026, 35295096, 8429233, 8601595, 8868467	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12702150, 12883358, 15292257, 18577517		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35538545	Stimulate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	7542641	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	1537623, 20054806, 29504367, 8651925		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	32705667	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	18096084, 22886525	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	22886525, 24084442, 24655565, 24884875		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	24084442	Inhibit	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	22886525, 24084442, 24884875, 30111297	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	27041584, 7536236		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	14972511, 20370680, 22966907		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	24069351, 30605433		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	31123248		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	11966474, 19200980, 20970123, 29224811	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	22132151, 24699672, 26926234, 34205649, 39941011	Associate	★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	29374695		★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	29555661		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10848782, 11841427, 17339423, 23450831, 25860485, 26775013, 28643330, 28670693, 32526706, 38035078, 39493694, 40481899, 7579410, 8634437, 8874209, 9649209	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	11840273, 11841427, 16046235, 17536013, 18850009, 19596856, 19965677, 20307537, 22517906, 23760401, 26429859, 30240956, 31423579, 31560141, 8520509, 8874209, 9823960		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	11840273		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	20586634	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	15990174		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	18195134, 27314687, 7507498		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	19666588, 37848007	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Muscular Dystrophy, Facioscapulohumeral	Facioscapulohumeral Muscular Dystrophy	BEFREE	10716758		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	12210602		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	12210602	Inhibit	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	20662087, 29799854	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	35289472	Stimulate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	16998483, 30154435, 31018977		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	16998483		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29746525		★☆☆☆☆ Found in Text Mining only
Nasodigitoacoustic syndrome	Nasodigitoacoustic syndrome	Pubtator	35168097	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	17611662, 18998154, 22591637, 22770970, 23285037, 23883608, 24186075, 24927072, 25268088, 26294655, 26568302, 28959019, 29740213, 30569106		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	23803658, 25268088, 26294655, 36107539, 39742726, 7538265	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	26294655	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	28569787	Associate	★☆☆☆☆ Found in Text Mining only
Nemaline myopathy 5	Nemaline myopathy	Pubtator	26572077	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10037277, 10229774, 10326795, 10344738, 10398281, 10414233, 10446451, 10470143, 10541973, 10547541, 10550296, 10553022, 10620458, 10783309, 10873090, 10911909, 11035936, 11054026, 11063638, 11066075, 11104615, 11115587, 11149422, 11180088, 11223672, 11263866, 11339835, 11350606, 11423990, 11582589, 11724345, 11982338, 12222834, 12469144, 12474536, 12508241, 12629514, 12692786, 12702150, 12782013, 12820426, 12842543, 12960282, 14533809, 14604992, 14695190, 14758731, 14966921, 14981907, 1500863, 15036650, 15059900, 15065603, 15129426, 15152948, 15313120, 15361838, 15701601, 15767360, 15783086, 15823810, 15981099, 16085055, 16311123, 16328056, 16354706, 16419149, 16478744, 16895556, 1717145, 17210912, 17252589, 1742741, 17513004, 17611662, 17945212, 18092951, 18162778, 18268494, 18339881, 18354082, 18539965, 18559090, 18560594, 18632604, 1919439, 19221883, 19246453, 19393131, 19528475, 19537946, 19596856, 19598259, 19713997, 19787202, 19794958, 19799609, 20019840, 20083228, 20150644, 20197461, 20200161, 20405247, 20428807, 20484027, 20488884, 20509143, 20530438, 20665103, 20802512, 20843027, 20843787, 20935265, 20940399, 20948317, 20971068, 21047255, 21087933, 21124918, 21156287, 21258793, 21282737, 21294122, 21304978, 21331451, 21357442, 21393860, 21397861, 21424816, 21471434, 21640118, 21692061, 21764578, 21835433, 21850700, 21925125, 21957977, 21978830, 22024282, 22031535, 22037257, 22119938, 22207173, 22225786, 22500655, 22552290, 22674792, 22692575, 22706704, 22751119, 22788972, 22898897, 22922740, 22923071, 22937154, 22948942, 23039365, 23091114, 23151220, 23208501, 23251004, 23265944, 23285037, 23314380, 23326564, 23354547, 23404221, 23404342, 23422486, 23437366, 23504987, 23547049, 23548270, 23565227, 23565736, 23600676, 23624503, 23633482, 23748175, 23764310, 23787217, 23791684, 23800986, 23806972, 23813303, 23838935, 23877317, 23955388, 23966295, 24008095, 24009708, 24036854, 24078448, 24091605, 24190252, 24318997, 24324613, 24356780, 24358304, 24395741, 24397969, 24492295, 24549646, 24647926, 24659820, 24670641, 24699672, 24709421, 24715151, 24734907, 24816422, 24824928, 24835590, 24947926, 24971320, 24980816, 25009318, 25123505, 25168019, 25212506, 25263481, 25278704, 25335738, 25351982, 25354268, 25404732, 25461272, 25515492, 25550556, 25551284, 25561796, 25605020, 25625240, 25728352, 25762343, 25797268, 25808439, 25823654, 25828473, 25868977, 25888636, 25897700, 25909162, 25912030, 26025766, 26079799, 26098778, 26119931, 26136504, 26189059, 26356590, 26367378, 26399460, 26407842, 26453158, 26456957, 26528725, 26540347, 26549522, 26552644, 26662954, 26687806, 26755529, 26840024, 26869223, 27055559, 27060154, 27062566, 27070574, 27107424, 27131799, 27197582, 27207438, 27237321, 27260988, 27300001, 27442811, 27447749, 27463372, 27490763, 27499099, 27550999, 27590006, 27612478, 27626695, 27630154, 27634934, 27680978, 27746219, 27775025, 27779682, 27804027, 27819672, 27823852, 27835603, 27835865, 27842858, 27873160, 27874296, 27910777, 27913065, 27931044, 28009986, 28032505, 28052035, 28059963, 28070170, 28148288, 28186864, 28208014, 28216300, 28255343, 28287265, 28326306, 28341962, 28393427, 28428713, 28442344, 28468972, 28518118, 28523303, 28523716, 28604612, 28621523, 28631562, 28645102, 28659655, 28663087, 28677737, 28677740, 28755734, 28851663, 28958879, 28990139, 29076344, 29078734, 29086481, 29115557, 29187403, 29192320, 29204252, 29216821, 29225052, 29239219, 29253924, 29277682, 29277856, 29296081, 29307338, 29318879, 29350904, 29377347, 29378465, 29386546, 29415537, 29423071, 29435053, 29468726, 29474960, 29534519, 29636610, 29671949, 29678787, 29682524, 29734248, 29745229, 29774098, 29791975, 29845398, 29888653, 29890464, 29890852, 29899207, 29914429, 29957956, 30018080, 30022822, 30033544, 30061637, 30105340, 30128900, 30143878, 30170067, 30179299, 30197996, 30200262, 30210550, 30211160, 30287007, 30288117, 30291867, 30334478, 30334571, 30361447, 30364293, 30387013, 30395540, 30396468, 30408413, 30430079, 30552846, 30562512, 30613295, 30650148, 30668131, 30693749, 30782931, 30788285, 30860027, 30880758, 30894570, 30909497, 30942083, 30950180, 31013093, 31033217, 31036052, 31073886, 31114754, 31147393, 31181310, 31207547, 31240496, 31300876, 31315262, 31341493, 31361756, 31362044, 31382969, 31389968, 31446534, 31470408, 31496695, 31512706, 31529191, 31541681, 31549393, 31571863, 31593802, 31619711, 31638182, 31685444, 31722999, 31730969, 31741714, 31746135, 31760908, 31762938, 31819089, 7508823, 7509720, 7513984, 7518345, 7518353, 7519124, 7520354, 7521786, 7530237, 7531611, 7534253, 7536236, 7537255, 7538103, 7544357, 7576964, 7585612, 7591962, 7692200, 8148709, 8320265, 8416989, 8528746, 8558206, 8562168, 8579108, 8599448, 8608987, 8640067, 8651925, 8669861, 8674003, 8682591, 8695347, 8740026, 8750190, 8780391, 8781700, 8807640, 8839552, 8858111, 8900434, 8905400, 8958311, 8985742, 8985743, 9027631, 9049847, 9058839, 9099963, 9102228, 9117309, 9187133, 9231152, 9243361, 9256826, 9316006, 9316589, 9333016, 9364462, 9413216, 9468523, 9494539, 9502080, 9516861, 9516862, 9588883, 9611772, 9634541, 9658313, 9721884, 9725567, 9777953, 9815753, 9833394, 9839501, 9887098, 9893637, 9893744, 9916943		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	31572382		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	LHGDN	19097357		★☆☆☆☆ Found in Text Mining only
Nephrocalcinosis	Nephrocalcinosis	BEFREE	27612997		★☆☆☆☆ Found in Text Mining only
NEPHROLITHIASIS, CALCIUM OXALATE	Nephronophthisis	CLINVAR_DG	24886237		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Nephrosis Lipoid	Nephrotic syndrome	Pubtator	37530333	Associate	★☆☆☆☆ Found in Text Mining only
Neural crest tumor	Neural Crest Tumor	BEFREE	8985743		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	30145722, 9354454		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10425558, 11035936, 12508241, 15355914, 17106870, 17947461, 1922057, 21424816, 23619990, 24190252, 28684419, 31685444, 7518353, 7576948, 7576963, 7576964, 9099963, 9102228, 9256826, 9516861, 9516862		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	Pubtator	17849363, 24173829, 38063204	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	Pubtator	1922057	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	40106490	Associate	★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	7508823, 8985743		★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	9354454		★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	9354454		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	Pubtator	20606732	Associate	★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	9354454, 9378774		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28323124		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	11014576, 11263866, 11320076, 16193174, 17513004, 23947765, 24595209, 25169522, 25335738, 25576211, 25955300, 26356590, 27500490, 27573351, 27819672, 28460475, 28499650, 28693170, 29110853, 29190547, 29552200, 29663359, 29845263, 30365189, 30515553, 30802432, 31406460, 9316006, 9662339, 9815811, 9846498		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	LHGDN	18265895		★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	28579829		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	28323124		★☆☆☆☆ Found in Text Mining only
Nongerminomatous Germ Cell Tumor	Nongerminomatous Tumor	BEFREE	9588883		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	16425351, 23208501, 23851504		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	11461706, 18952835, 22433859, 23801032		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	22433859	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	21188630, 30179299, 31496817		★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	LHGDN	12635659, 12908752		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	28397583		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	34024796	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	14609532, 20203421, 21953087, 25807374, 33051414, 40102843	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	27803113		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	27238423		★☆☆☆☆ Found in Text Mining only
Osteogenesis Imperfecta	Osteogenesis Imperfecta	BEFREE	7484289		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	15781582		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	19580891		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	37318459	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	10541973, 23031740, 23314380, 23565227, 26079799, 28666726, 29371972, 29672299, 30504723, 30644615, 30682240, 31047947, 31496695		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	10541973, 22870217, 23031740, 26603906, 30177521, 35264209, 35744840	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	12479099		★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	BEFREE	31226944		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	10470114, 22350800, 24036854, 28675028		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	25658794		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	16908592, 23874550, 33218351, 33634678, 37094499	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian Hyperstimulation Syndrome	BEFREE	17074323		★☆☆☆☆ Found in Text Mining only
Ovarian Mucinous Adenocarcinoma	Ovarian adenocarcinoma	BEFREE	29374695		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	10053108, 10628329, 11063638, 11115587, 21541039, 21963846, 22350800, 22498306, 23492823, 23565736, 23730209, 24824928, 25515492, 25658794, 25687880, 25823654, 27253518, 27300001, 28070170, 28123528, 29130517, 29730663, 30121075, 31186752, 31497537, 7543560, 8519665, 8669861, 9216637, 9494539, 9815989		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	14614016, 17092940		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10329605, 11063642, 11839564, 16229685, 16908592, 18441325, 20428807, 20952655, 21294926, 23468946, 23565736, 23664487, 23824740, 24124770, 24408020, 25545504, 27253518, 27590006, 28212584, 28627617, 28726781, 28731164, 31752757, 32192517, 32242101, 32390009, 33270665, 33627162, 33634678, 36768723, 37342066, 37628927, 38415537, 8519665, 9346940, 9413956, 9826464	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25658794	Stimulate	★☆☆☆☆ Found in Text Mining only
Oxyphilic Adenoma	Oxyphilic Adenoma	BEFREE	21887686		★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	17343740, 30206982		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	12841682, 17446842, 19598259, 22322379, 22963768, 23036582, 23679813, 24132924, 24397969, 24708709, 24719318, 24734907, 25566991, 25684468, 26077342, 26261555, 27893718, 28400334, 28507102, 28575959, 28659655, 28789349, 29106581, 29683068, 29750031, 30285798, 30348713, 30360026, 31724100, 7544799, 8573713, 9351541, 9489913, 9737888, 9816340, 9849582		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	26880805, 28064441, 28421110, 30655325, 31049070		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	11501843, 23094026, 24397969, 26880805, 30285798, 31312365		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	CTD_human_DG	17446842		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	10811495, 15817123, 20426768, 21673909, 22335271, 22457533, 23679813, 24521357, 24708709, 25240521, 26261555, 26458814, 26666511, 27267855, 27283965, 27748818, 27789528, 28659655, 29106581, 29107110, 30318866, 30456933, 30942874, 31662520, 33498866, 33921242, 34675409, 34753802, 35846884, 35931675, 36292918, 37880235, 8416989, 9849582	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatitis	Pancreatitis	Pubtator	26261555, 26546043, 26572077, 36142575, 36671463	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	9737888		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	15701601, 23685894, 24273003, 24654752, 28687160, 7553635, 8640758		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	Pubtator	23143465	Associate	★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	11197119		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29519253		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	35732154	Associate	★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	28599481		★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	16761672	Associate	★☆☆☆☆ Found in Text Mining only
Penile hypospadias	Penile Hypospadias	BEFREE	17161332		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	38567731	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	24476546		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	38567731	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	10879740		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	15167935, 9577373	Associate	★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	26782791		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	23895705, 29556628	Associate	★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	20074564, 8944429		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	28068351, 31735954		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	33047155	Associate	★☆☆☆☆ Found in Text Mining only
Polyposis, Adenomatous Intestinal	Multiple polyposis syndrome	CTD_human_DG	28255344		★☆☆☆☆ Found in Text Mining only
Precocious Puberty	Precocious puberty	BEFREE	11936470, 9661624		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	23263849, 28569787		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	16998483, 1833412, 18398738, 23263849, 28395118, 30430079		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	23086478, 26708679, 29781813, 30430079		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	10586428		★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	23372684		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10344738, 10911909, 10950120, 11096236, 11223672, 11582589, 12576866, 12926045, 14517837, 15289848, 16158948, 16328056, 16886606, 18268494, 20200161, 20370680, 20454608, 21138868, 21190562, 21282737, 21607288, 21953074, 22552290, 22870202, 23027394, 23166824, 23188675, 24549646, 24615685, 24659666, 24832177, 25216351, 25349289, 25483103, 25661993, 26624980, 27447749, 27893706, 28083789, 28256535, 28442344, 28758908, 28789597, 29029419, 29228713, 29358129, 29423071, 29682524, 29894706, 30112117, 30554119, 30633985, 30904606, 30930999, 31187175, 31315262, 31561211, 7510214, 7544357, 8628718, 8839552, 9492843, 9552030, 9815753, 9935187		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	28083789	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	10193318, 15107804, 16207477, 16886606, 17343740, 17998819, 18057003, 18793421, 19116269, 19582779, 20021671, 20200161, 20454608, 20565761, 21647815, 22038225, 22215106, 22719071, 22966907, 23450810, 23936228, 24659666, 24832177, 25661993, 25693083, 25850653, 26231042, 26485709, 26537072, 26636522, 27893706, 28083789, 28442344, 28758908, 28789597, 29726910, 30754655, 30935014, 33218199, 33910833, 34045601, 36593027, 36643861, 37378942, 40141159	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	10398281, 30728896, 7544357, 7544562, 8628718		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	10950120	Inhibit	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17343740, 17638891		★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	18032547, 37108355	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	35848967	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	15802338, 25573300	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	23148928	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	21708929, 31410197, 31509965		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	22923071, 22969228, 23571142, 23787217, 26456957, 30504405, 30860617		★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	LHGDN	17589956		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	31534630, 7591962, 9045950		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	12474536, 17607380, 24866595, 25123505, 26850779, 29243496, 30872677, 31053527, 7521786, 7591962, 8958311		★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	29276101		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	29609546		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	37925496	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	28138561		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	3926382		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	10620458, 24324613, 26851004, 29162051		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	22278416, 22328825, 29162051, 36362243	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	10360676	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10616194, 11466334, 12209509, 12643440, 12697740, 16849507, 17383158, 25708025, 29516758, 9247577, 9918236, 9973520		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	17383158		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	34334005, 37206297, 39226877	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	23419168, 34161412, 35848479	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Pleomorphic Adenoma	Pleomorphic adenoma of salivary gland	BEFREE	23600676		★☆☆☆☆ Found in Text Mining only
Sarcoglycanopathies	Sarcoglycanopathies	Pubtator	10397078	Inhibit	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	10574596, 10917171, 17487380, 19996285, 29433875, 31662543		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	15154622, 29433875, 8416989	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	26189059, 37511533	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Experimental	Sarcoma	Pubtator	2687294	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	33070392	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	18240216		★☆☆☆☆ Found in Text Mining only
Sclerosis	Sclerosis	Pubtator	37530333	Associate	★☆☆☆☆ Found in Text Mining only
Sebaceous Adenocarcinoma	Sebaceous Adenocarcinoma	BEFREE	29760516		★☆☆☆☆ Found in Text Mining only
Sebaceous Gland Neoplasms	Sebaceous gland neoplasms	Pubtator	29760516	Associate	★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	28693269, 30899442, 9849461		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	9588883		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	9588883	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29939250		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	9243361		★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	19507218	Associate	★☆☆☆☆ Found in Text Mining only
SIMPSON-GOLABI-BEHMEL SYNDROME, TYPE 1	Simpson-Golabi-Behmel Syndrome	BEFREE	8958336		★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	12377743, 30236312		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	8682591		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	23469181, 25335738, 29277856, 31446534, 7509720, 9846498		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	17327908, 33607458, 34228218, 34363352	Associate	★☆☆☆☆ Found in Text Mining only
Spherocytosis Hereditary	Spherocytosis	Pubtator	20179084, 27784127	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10750777, 12239634, 17679465, 19582427, 20586780, 21124918, 21198869, 22740085, 22770970, 23422152, 23437366, 23469181, 24019906, 24699672, 25335738, 25482572, 26391478, 26926234, 28214216, 28645102, 29468726, 29693240, 29752852, 29791975, 29805672, 31742606, 8599448, 8635860, 8691348, 8869105, 8959559, 9027631, 9258720, 9316006, 9682981, 9725567, 9790096		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	15645378, 16565089, 17679465, 18516325, 18852874		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	23797812, 27680978, 28414310, 28927233, 29094237, 30992079, 31807530, 31809227		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	10804289, 16080532, 18396788, 18852874, 19507218, 19602232, 20848440, 21685938, 22242150, 22333601, 22384257, 22847005, 23049743, 23143465, 23235720, 23265944, 23992541, 24122205, 24156023, 24527751, 24533098, 24699672, 24883329, 25280025, 25471937, 26626427, 26926234, 27213496, 28035370, 28631562, 29171106, 29760516, 29888653, 29949786, 30272273, 30782931, 32588101, 32597160, 34205649, 34435915, 34655409, 35075092, 35274800, 35296132, 35435358, 35848480, 36261806, 36498950, 38406907, 39412907, 9390199	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	38096163	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lip	Carcinoma of Lip	BEFREE	28523303, 29779037		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	11263866		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	28923838, 30303590		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	22014666, 24156023, 30077625, 30079604		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	17679465, 25400809, 31081044, 31809227, 8688968		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	11283501, 15767360, 17210912, 17252589, 17935121, 21294122, 21493336, 21685938, 21850700, 22847005, 23049743, 23265944, 23903875, 24403253, 24709421, 25104726, 25471937, 25751671, 26239260, 26399460, 27442811, 28035370, 28837080, 28865486, 29097914, 29192320, 29760516, 29888653, 29992954, 30552846, 31571863, 31593802, 31742606		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of vulva	Carcinoma Of Vulva	BEFREE	8674003		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	30236312		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	31090233		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	18952835, 28323124, 30689936		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	29433875, 30999901		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	10439835, 11066075, 12692839, 16440414, 20856229, 21105049, 21331451, 21471434, 21678082, 22839505, 23179610, 23188090, 23900519, 24481453, 25009318, 25081334, 25212506, 25277524, 25479940, 26035691, 26119931, 26140900, 26416034, 26552644, 26918728, 27107424, 27187279, 27323782, 27931044, 28123556, 28184940, 28186678, 28212584, 28326835, 28415792, 28428713, 28692437, 28694503, 29090670, 29445738, 29450424, 29845783, 29858680, 29862663, 30147339, 30165890, 30349314, 30543303, 31077346, 7520354, 7531611, 7692200, 8636005, 8658214, 9291438, 9390037, 9443088, 9772282		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	20093404, 21829201, 8707078	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	10037277, 10391086, 16419149, 16440414, 20856229, 21105049, 21471434, 21829201, 21912471, 22135720, 22408359, 22606006, 22839505, 23229446, 23245321, 23539643, 25212506, 25286029, 25441488, 25576211, 25779358, 26774363, 26940070, 27323782, 27923017, 27931044, 28239031, 28428713, 28430578, 28440445, 28694503, 29445738, 29802692, 29917191, 30375477, 30485589, 30913874, 30963578, 31077346, 32592354, 34060205, 34135559, 35363934, 35418175, 35595817, 35786646, 36316684, 36439876, 36528833, 36918410, 37277751, 38319150, 38546403, 39684426, 8707078, 9443088	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	LHGDN	16311123, 17332338		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	21471434		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	22791956, 30177521	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	29445738	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	27671249		★☆☆☆☆ Found in Text Mining only
Subfertility	Subfertility	BEFREE	16730882		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	11466334, 22218639		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	18240216		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	10879740		★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	12469144, 18092951, 26662954		★☆☆☆☆ Found in Text Mining only
Tendinopathy	Tendinopathy	BEFREE	28091588, 31732563		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	9588883	Associate	★☆☆☆☆ Found in Text Mining only
Testotoxicosis	Testotoxicosis	BEFREE	19492585		★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	12842543		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	25342622, 30947333		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	21151388, 24654752, 31341151, 35213720	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	26678979	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	10537343, 22271686, 24654752, 24727741, 30160089, 9387900		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	24727741	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	39984992	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	9589486		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	24654752, 24727741, 30160089, 9387900, 9589486		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	19530676, 24654752, 26542767, 30069928, 32793117, 35528004, 9045959	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	21151388, 39595993	Associate	★☆☆☆☆ Found in Text Mining only
Tic disorder	Tic Disorder	BEFREE	27789528, 28052035		★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	23235720	Inhibit	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	24069434, 26662954, 30286252		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	21334874, 24167614	Stimulate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	21835433, 22626806, 22674792, 22937154, 23982961, 24008095, 26528725, 26963129, 27654639, 28528300, 28760736, 28859899, 29113223, 29129754, 29190901, 29277682, 29471829, 29678787, 29777999, 29964098, 30093560, 30334478, 30566834, 30640712, 30894512, 31496817, 31674634, 31722999, 31756533		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	22626806, 22937154, 24008095, 26963129, 27994520, 29471829, 29925435, 30628666, 31450894, 32546966, 35090088, 35725558, 37077065, 38188613	Associate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	19912235	Associate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis 1	Tuberous sclerosis complex	Pubtator	22870217	Inhibit	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	21473743, 31103945, 7537840		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	10550296, 24491153, 24716927, 25551284, 25826491, 27595989, 28156048, 31222373, 31529191, 32434417, 33924987, 35547758, 37316699, 8148709, 8749947, 8780391	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	26990746, 31279874, 31529191, 31569404, 31718471		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	19900133, 36768853, 37148002	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	24606473, 32975231, 35942212, 37148002	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	33047155	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	10574596		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	17003493	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	8640067		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	34685653	Inhibit	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	CTD_human_DG	22561518		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	20528783	Associate	★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	23372684	Stimulate	★☆☆☆☆ Found in Text Mining only