Gene Gene information from NCBI Gene database.
Entrez ID 9595
Gene name Cytohesin 1 interacting protein
Gene symbol CYTIP
Synonyms (NCBI Gene)
B3-1CASPCYBRCYTHIPHEPSCDBP
Chromosome 2
Chromosome location 2q24.1
Summary The protein encoded by this gene contains 2 leucine zipper domains and a putative C-terminal nuclear targeting signal, but does not have any hydrophobic regions. This protein is expressed weakly in resting NK and T cells. The encoded protein modulates the
miRNA miRNA information provided by mirtarbase database.
196
miRTarBase ID miRNA Experiments Reference
MIRT018497 hsa-miR-335-5p Microarray 18185580
MIRT029853 hsa-miR-26b-5p Microarray 19088304
MIRT668795 hsa-miR-4668-3p HITS-CLIP 23706177
MIRT668794 hsa-miR-3925-5p HITS-CLIP 23706177
MIRT668793 hsa-miR-146a-5p HITS-CLIP 23706177
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 11867758, 28514442, 32296183, 32814053, 33961781
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IDA 12606567
GO:0005737 Component Cytoplasm IEA
GO:0005768 Component Endosome IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604448 9506 ENSG00000115165
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O60759
Protein name Cytohesin-interacting protein (Cytohesin binder and regulator) (CYBR) (Cytohesin-associated scaffolding protein) (CASP) (Cytohesin-binding protein HE) (Cbp HE) (Pleckstrin homology Sec7 and coiled-coil domains-binding protein)
Protein function By its binding to cytohesin-1 (CYTH1), it modifies activation of ARFs by CYTH1 and its precise function may be to sequester CYTH1 in the cytoplasm.
PDB 2Z17
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00595 PDZ 77 163 PDZ domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in lymph nodes, thymus, spleen, lung, peripheral blood leukocytes and bone marrow. {ECO:0000269|PubMed:11867758, ECO:0000269|PubMed:12606567}.
Sequence
MSLQRLLQHSSNGNLADFCAGPAYSSYSTLTGSLTMDDNRRIQMLADTVATLPRGRKQLA
LTRSSSLSDFSWSQRKLVTVEKQDNETFGFEIQSYRPQNQNACSSEMFTLICKIQEDSPA
HCAGLQAGDVLANINGVSTEGFTYKQVVDLIRSSGNLLTIETL
NGTMILKRTELEAKLQV
LKQTLKQKWVEYRSLQLQEHRLLHGDAANCPSLENMDLDELSLFGPLPGPGPALVDRNRL
SSESSCKSWLSSMTMDSEDGYQTCVSEDSSRGAFSRQTSTDDECFIPKEGDDFLRRSSSR
RNRSISNTSSGSMSPLWEGNLSSMFGTLPRKSRKGSVRKQLLKFIPGLHRAVEEEESRF
Sequence length 359
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
DYSLEXIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
GOUT GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
beta Thalassemia Beta thalassemia Pubtator 37816374 Associate
★☆☆☆☆
Found in Text Mining only
Brain Neoplasms Brain Neoplasms BEFREE 30042341
★☆☆☆☆
Found in Text Mining only
Carcinoma Carcinoma BEFREE 16948818, 20025484, 20402676
★☆☆☆☆
Found in Text Mining only
Carcinoma of lung Lung carcinoma BEFREE 20661084, 23315881
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer BEFREE 16948818, 23303631
★☆☆☆☆
Found in Text Mining only
Dementia Dementia BEFREE 29356567
★☆☆☆☆
Found in Text Mining only
Depressive disorder Mental Depression BEFREE 26404725, 29356567, 29529559, 30596467
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus Type 2 Diabetes mellitus, type 2 Pubtator 37364045 Associate
★☆☆☆☆
Found in Text Mining only
Gastrointestinal Stromal Tumors Gastrointestinal stromal tumor BEFREE 19269008
★☆☆☆☆
Found in Text Mining only
Liver carcinoma Liver carcinoma BEFREE 28453560
★☆☆☆☆
Found in Text Mining only