Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9589
Gene name	WT1 associated protein
Gene symbol	WTAP
Synonyms (NCBI Gene)	Mum2
Chromosome	6
Chromosome location	6q25.3
Summary	The Wilms tumor suppressor gene WT1 appears to play a role in both transcriptional and posttranscriptional regulation of certain cellular genes. This gene encodes a WT1-associating protein, which is a ubiquitously expressed nuclear protein. Like WT1 prote

253

Show/Hide all (253)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019716	hsa-miR-375	Microarray	20215506
MIRT022388	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT510557	hsa-miR-548n	PAR-CLIP	20371350
MIRT510556	hsa-miR-548an	PAR-CLIP	20371350
MIRT510555	hsa-miR-548l	PAR-CLIP	20371350
MIRT564977	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT510554	hsa-miR-586	PAR-CLIP	20371350
MIRT564976	hsa-miR-4638-3p	PAR-CLIP	20371350
MIRT564975	hsa-miR-378a-3p	PAR-CLIP	20371350
MIRT564974	hsa-miR-378b	PAR-CLIP	20371350
MIRT564973	hsa-miR-378c	PAR-CLIP	20371350
MIRT564972	hsa-miR-378d	PAR-CLIP	20371350
MIRT564971	hsa-miR-378e	PAR-CLIP	20371350
MIRT564970	hsa-miR-378f	PAR-CLIP	20371350
MIRT564969	hsa-miR-378h	PAR-CLIP	20371350
MIRT564968	hsa-miR-378i	PAR-CLIP	20371350
MIRT564967	hsa-miR-422a	PAR-CLIP	20371350
MIRT510553	hsa-miR-4504	PAR-CLIP	20371350
MIRT510552	hsa-miR-542-3p	PAR-CLIP	20371350
MIRT564966	hsa-miR-4775	PAR-CLIP	20371350
MIRT564965	hsa-miR-1299	PAR-CLIP	20371350
MIRT564964	hsa-miR-516b-5p	PAR-CLIP	20371350
MIRT564963	hsa-miR-4782-5p	PAR-CLIP	20371350
MIRT564962	hsa-miR-5706	PAR-CLIP	20371350
MIRT510551	hsa-miR-6808-3p	PAR-CLIP	20371350
MIRT510550	hsa-miR-758-3p	PAR-CLIP	20371350
MIRT510557	hsa-miR-548n	PAR-CLIP	23446348
MIRT510556	hsa-miR-548an	PAR-CLIP	23446348
MIRT510555	hsa-miR-548l	PAR-CLIP	23446348
MIRT510554	hsa-miR-586	PAR-CLIP	23446348
MIRT510553	hsa-miR-4504	PAR-CLIP	23446348
MIRT510552	hsa-miR-542-3p	PAR-CLIP	23446348
MIRT510551	hsa-miR-6808-3p	PAR-CLIP	23446348
MIRT510550	hsa-miR-758-3p	PAR-CLIP	23446348
MIRT510557	hsa-miR-548n	PAR-CLIP	20371350
MIRT510556	hsa-miR-548an	PAR-CLIP	20371350
MIRT510555	hsa-miR-548l	PAR-CLIP	20371350
MIRT564977	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT510554	hsa-miR-586	PAR-CLIP	20371350
MIRT564976	hsa-miR-4638-3p	PAR-CLIP	20371350
MIRT564975	hsa-miR-378a-3p	PAR-CLIP	20371350
MIRT564974	hsa-miR-378b	PAR-CLIP	20371350
MIRT564973	hsa-miR-378c	PAR-CLIP	20371350
MIRT564972	hsa-miR-378d	PAR-CLIP	20371350
MIRT564971	hsa-miR-378e	PAR-CLIP	20371350
MIRT564970	hsa-miR-378f	PAR-CLIP	20371350
MIRT564969	hsa-miR-378h	PAR-CLIP	20371350
MIRT564968	hsa-miR-378i	PAR-CLIP	20371350
MIRT564967	hsa-miR-422a	PAR-CLIP	20371350
MIRT510553	hsa-miR-4504	PAR-CLIP	20371350
MIRT510552	hsa-miR-542-3p	PAR-CLIP	20371350
MIRT564966	hsa-miR-4775	PAR-CLIP	20371350
MIRT564965	hsa-miR-1299	PAR-CLIP	20371350
MIRT564964	hsa-miR-516b-5p	PAR-CLIP	20371350
MIRT564963	hsa-miR-4782-5p	PAR-CLIP	20371350
MIRT564962	hsa-miR-5706	PAR-CLIP	20371350
MIRT510551	hsa-miR-6808-3p	PAR-CLIP	20371350
MIRT510550	hsa-miR-758-3p	PAR-CLIP	20371350
MIRT510557	hsa-miR-548n	PAR-CLIP	23446348
MIRT510556	hsa-miR-548an	PAR-CLIP	23446348
MIRT510555	hsa-miR-548l	PAR-CLIP	23446348
MIRT510554	hsa-miR-586	PAR-CLIP	23446348
MIRT510553	hsa-miR-4504	PAR-CLIP	23446348
MIRT510552	hsa-miR-542-3p	PAR-CLIP	23446348
MIRT510551	hsa-miR-6808-3p	PAR-CLIP	23446348
MIRT510550	hsa-miR-758-3p	PAR-CLIP	23446348
MIRT1494456	hsa-miR-101	CLIP-seq
MIRT1494457	hsa-miR-1243	CLIP-seq
MIRT1494458	hsa-miR-1276	CLIP-seq
MIRT1494459	hsa-miR-1289	CLIP-seq
MIRT1494460	hsa-miR-144	CLIP-seq
MIRT1494461	hsa-miR-194	CLIP-seq
MIRT1494462	hsa-miR-23a	CLIP-seq
MIRT1494463	hsa-miR-23b	CLIP-seq
MIRT1494464	hsa-miR-23c	CLIP-seq
MIRT1494465	hsa-miR-3148	CLIP-seq
MIRT1494466	hsa-miR-3163	CLIP-seq
MIRT1494467	hsa-miR-3165	CLIP-seq
MIRT1494468	hsa-miR-3171	CLIP-seq
MIRT1494469	hsa-miR-3198	CLIP-seq
MIRT1494470	hsa-miR-3613-5p	CLIP-seq
MIRT1494471	hsa-miR-3654	CLIP-seq
MIRT1494472	hsa-miR-3942-5p	CLIP-seq
MIRT1494473	hsa-miR-4282	CLIP-seq
MIRT1494474	hsa-miR-4289	CLIP-seq
MIRT1494475	hsa-miR-4294	CLIP-seq
MIRT1494476	hsa-miR-4309	CLIP-seq
MIRT1494477	hsa-miR-4311	CLIP-seq
MIRT1494478	hsa-miR-4427	CLIP-seq
MIRT1494479	hsa-miR-4477b	CLIP-seq
MIRT1494480	hsa-miR-4662a-3p	CLIP-seq
MIRT1494481	hsa-miR-4680-3p	CLIP-seq
MIRT1494482	hsa-miR-4698	CLIP-seq
MIRT1494483	hsa-miR-4700-3p	CLIP-seq
MIRT1494484	hsa-miR-4703-5p	CLIP-seq
MIRT1494485	hsa-miR-4709-5p	CLIP-seq
MIRT1494486	hsa-miR-4731-3p	CLIP-seq
MIRT1494487	hsa-miR-4738-3p	CLIP-seq
MIRT1494488	hsa-miR-4744	CLIP-seq
MIRT1494489	hsa-miR-4764-3p	CLIP-seq
MIRT1494490	hsa-miR-4766-3p	CLIP-seq
MIRT1494491	hsa-miR-4790-3p	CLIP-seq
MIRT1494492	hsa-miR-4801	CLIP-seq
MIRT1494493	hsa-miR-513a-3p	CLIP-seq
MIRT1494494	hsa-miR-548a-3p	CLIP-seq
MIRT1494495	hsa-miR-548ac	CLIP-seq
MIRT1494496	hsa-miR-548ae	CLIP-seq
MIRT1494497	hsa-miR-548aj	CLIP-seq
MIRT1494498	hsa-miR-548am	CLIP-seq
MIRT1494499	hsa-miR-548c-3p	CLIP-seq
MIRT1494500	hsa-miR-548d-3p	CLIP-seq
MIRT1494501	hsa-miR-548e	CLIP-seq
MIRT1494502	hsa-miR-548f	CLIP-seq
MIRT1494503	hsa-miR-548g	CLIP-seq
MIRT1494504	hsa-miR-548x	CLIP-seq
MIRT1494505	hsa-miR-548z	CLIP-seq
MIRT1494506	hsa-miR-583	CLIP-seq
MIRT1494507	hsa-miR-587	CLIP-seq
MIRT1494508	hsa-miR-606	CLIP-seq
MIRT1494509	hsa-miR-802	CLIP-seq
MIRT1494457	hsa-miR-1243	CLIP-seq
MIRT1494510	hsa-miR-129-5p	CLIP-seq
MIRT1494511	hsa-miR-139-5p	CLIP-seq
MIRT1494512	hsa-miR-1468	CLIP-seq
MIRT1494513	hsa-miR-1910	CLIP-seq
MIRT1494514	hsa-miR-3179	CLIP-seq
MIRT1494515	hsa-miR-3202	CLIP-seq
MIRT1494516	hsa-miR-320a	CLIP-seq
MIRT1494517	hsa-miR-320b	CLIP-seq
MIRT1494518	hsa-miR-320c	CLIP-seq
MIRT1494519	hsa-miR-320d	CLIP-seq
MIRT1494471	hsa-miR-3654	CLIP-seq
MIRT1494520	hsa-miR-4271	CLIP-seq
MIRT1494521	hsa-miR-4328	CLIP-seq
MIRT1494522	hsa-miR-4429	CLIP-seq
MIRT1494523	hsa-miR-448	CLIP-seq
MIRT1494524	hsa-miR-450b-5p	CLIP-seq
MIRT1494525	hsa-miR-4666-5p	CLIP-seq
MIRT1494526	hsa-miR-4668-5p	CLIP-seq
MIRT1494527	hsa-miR-4725-3p	CLIP-seq
MIRT1494528	hsa-miR-4747-5p	CLIP-seq
MIRT1494529	hsa-miR-4761-5p	CLIP-seq
MIRT1494530	hsa-miR-4797-3p	CLIP-seq
MIRT1494531	hsa-miR-507	CLIP-seq
MIRT1494532	hsa-miR-557	CLIP-seq
MIRT1494533	hsa-miR-582-5p	CLIP-seq
MIRT1494456	hsa-miR-101	CLIP-seq
MIRT2148955	hsa-miR-1324	CLIP-seq
MIRT1494460	hsa-miR-144	CLIP-seq
MIRT2148956	hsa-miR-1911	CLIP-seq
MIRT1494461	hsa-miR-194	CLIP-seq
MIRT1494465	hsa-miR-3148	CLIP-seq
MIRT2148957	hsa-miR-3941	CLIP-seq
MIRT1494478	hsa-miR-4427	CLIP-seq
MIRT2148958	hsa-miR-466	CLIP-seq
MIRT2148959	hsa-miR-4672	CLIP-seq
MIRT1494481	hsa-miR-4680-3p	CLIP-seq
MIRT1494491	hsa-miR-4790-3p	CLIP-seq
MIRT2148960	hsa-miR-4799-5p	CLIP-seq
MIRT1494509	hsa-miR-802	CLIP-seq
MIRT1494466	hsa-miR-3163	CLIP-seq
MIRT1494499	hsa-miR-548c-3p	CLIP-seq
MIRT1494525	hsa-miR-4666-5p	CLIP-seq
MIRT2148955	hsa-miR-1324	CLIP-seq
MIRT2148957	hsa-miR-3941	CLIP-seq
MIRT2148958	hsa-miR-466	CLIP-seq
MIRT2148959	hsa-miR-4672	CLIP-seq
MIRT2434856	hsa-miR-4789-5p	CLIP-seq
MIRT2148960	hsa-miR-4799-5p	CLIP-seq
MIRT1494457	hsa-miR-1243	CLIP-seq
MIRT2663013	hsa-miR-1251	CLIP-seq
MIRT2663014	hsa-miR-128	CLIP-seq
MIRT1494510	hsa-miR-129-5p	CLIP-seq
MIRT1494512	hsa-miR-1468	CLIP-seq
MIRT2663015	hsa-miR-1912	CLIP-seq
MIRT2663016	hsa-miR-216b	CLIP-seq
MIRT2663017	hsa-miR-224	CLIP-seq
MIRT2663018	hsa-miR-24	CLIP-seq
MIRT2663019	hsa-miR-3065-5p	CLIP-seq
MIRT2663020	hsa-miR-3119	CLIP-seq
MIRT2663021	hsa-miR-320e	CLIP-seq
MIRT2663022	hsa-miR-323-3p	CLIP-seq
MIRT2663023	hsa-miR-3613-3p	CLIP-seq
MIRT1494471	hsa-miR-3654	CLIP-seq
MIRT2663024	hsa-miR-3675-3p	CLIP-seq
MIRT2663025	hsa-miR-371b-5p	CLIP-seq
MIRT2663026	hsa-miR-421	CLIP-seq
MIRT2663027	hsa-miR-4284	CLIP-seq
MIRT2663028	hsa-miR-433	CLIP-seq
MIRT2663029	hsa-miR-4457	CLIP-seq
MIRT2663030	hsa-miR-4464	CLIP-seq
MIRT2663031	hsa-miR-4474-3p	CLIP-seq
MIRT1494523	hsa-miR-448	CLIP-seq
MIRT2663032	hsa-miR-4490	CLIP-seq
MIRT2663033	hsa-miR-4520a-3p	CLIP-seq
MIRT1494525	hsa-miR-4666-5p	CLIP-seq
MIRT2663034	hsa-miR-4668-3p	CLIP-seq
MIRT2148959	hsa-miR-4672	CLIP-seq
MIRT2663035	hsa-miR-4682	CLIP-seq
MIRT1494486	hsa-miR-4731-3p	CLIP-seq
MIRT2663036	hsa-miR-4748	CLIP-seq
MIRT2663037	hsa-miR-4760-3p	CLIP-seq
MIRT1494529	hsa-miR-4761-5p	CLIP-seq
MIRT2663038	hsa-miR-4768-5p	CLIP-seq
MIRT2663039	hsa-miR-4774-5p	CLIP-seq
MIRT2663040	hsa-miR-4795-3p	CLIP-seq
MIRT1494492	hsa-miR-4801	CLIP-seq
MIRT2663041	hsa-miR-488	CLIP-seq
MIRT2663042	hsa-miR-494	CLIP-seq
MIRT2663043	hsa-miR-545	CLIP-seq
MIRT2663044	hsa-miR-593	CLIP-seq
MIRT2663045	hsa-miR-624	CLIP-seq
MIRT2663046	hsa-miR-627	CLIP-seq
MIRT2663047	hsa-miR-659	CLIP-seq
MIRT2663048	hsa-miR-885-5p	CLIP-seq
MIRT2663049	hsa-miR-924	CLIP-seq
MIRT1494457	hsa-miR-1243	CLIP-seq
MIRT2663013	hsa-miR-1251	CLIP-seq
MIRT2663014	hsa-miR-128	CLIP-seq
MIRT1494510	hsa-miR-129-5p	CLIP-seq
MIRT1494512	hsa-miR-1468	CLIP-seq
MIRT2663016	hsa-miR-216b	CLIP-seq
MIRT2663017	hsa-miR-224	CLIP-seq
MIRT2663018	hsa-miR-24	CLIP-seq
MIRT2663020	hsa-miR-3119	CLIP-seq
MIRT2663021	hsa-miR-320e	CLIP-seq
MIRT2663022	hsa-miR-323-3p	CLIP-seq
MIRT1494471	hsa-miR-3654	CLIP-seq
MIRT2663024	hsa-miR-3675-3p	CLIP-seq
MIRT2663027	hsa-miR-4284	CLIP-seq
MIRT2663028	hsa-miR-433	CLIP-seq
MIRT2663029	hsa-miR-4457	CLIP-seq
MIRT2663031	hsa-miR-4474-3p	CLIP-seq
MIRT1494523	hsa-miR-448	CLIP-seq
MIRT2663032	hsa-miR-4490	CLIP-seq
MIRT2663033	hsa-miR-4520a-3p	CLIP-seq
MIRT1494525	hsa-miR-4666-5p	CLIP-seq
MIRT2663034	hsa-miR-4668-3p	CLIP-seq
MIRT2148959	hsa-miR-4672	CLIP-seq
MIRT1494486	hsa-miR-4731-3p	CLIP-seq
MIRT2663037	hsa-miR-4760-3p	CLIP-seq
MIRT1494529	hsa-miR-4761-5p	CLIP-seq
MIRT2663038	hsa-miR-4768-5p	CLIP-seq
MIRT2663039	hsa-miR-4774-5p	CLIP-seq
MIRT2663040	hsa-miR-4795-3p	CLIP-seq
MIRT1494492	hsa-miR-4801	CLIP-seq
MIRT2663041	hsa-miR-488	CLIP-seq
MIRT2663042	hsa-miR-494	CLIP-seq
MIRT2663043	hsa-miR-545	CLIP-seq
MIRT2663044	hsa-miR-593	CLIP-seq
MIRT2663045	hsa-miR-624	CLIP-seq
MIRT2663047	hsa-miR-659	CLIP-seq
MIRT2663048	hsa-miR-885-5p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
WT1	Unknown	17095724

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000381	Process	Regulation of alternative mRNA splicing, via spliceosome	IBA
GO:0000381	Process	Regulation of alternative mRNA splicing, via spliceosome	IEA
GO:0000381	Process	Regulation of alternative mRNA splicing, via spliceosome	IMP	24407421
GO:0005515	Function	Protein binding	IPI	15161933, 16189514, 24316715, 25416956, 28514442, 29507755, 32296183, 32814053, 33961781, 35271311
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	10942595, 24316715, 26458103
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	29507755
GO:0005654	Component	Nucleoplasm	IDA	24100041
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0006397	Process	MRNA processing	IEA
GO:0006397	Process	MRNA processing	IMP	24316715, 24407421, 24981863
GO:0008380	Process	RNA splicing	IEA
GO:0016556	Process	MRNA modification	IEA
GO:0016607	Component	Nuclear speck	IDA	24100041, 24407421
GO:0016607	Component	Nuclear speck	IEA
GO:0031965	Component	Nuclear membrane	IDA	10942595
GO:0036396	Component	RNA N6-methyladenosine methyltransferase complex	IDA	24316715, 24407421, 24981863, 29348140, 29506078, 29507755
GO:0036396	Component	RNA N6-methyladenosine methyltransferase complex	IPI	29507755
GO:0042802	Function	Identical protein binding	IPI	32296183

MIM	HGNC	e!Ensembl
605442	16846	ENSG00000146457

Q15007

Protein name

Pre-mRNA-splicing regulator WTAP (Female-lethal(2)D homolog) (hFL(2)D) (WT1-associated protein) (Wilms tumor 1-associating protein)

Protein function

Associated component of the WMM complex, a complex that mediates N6-methyladenosine (m6A) methylation of RNAs, a modification that plays a role in the efficiency of mRNA splicing and RNA processing (PubMed:29507755). Required for accumulation of

PDB

7VF2 , 7VF5 , 7YFJ , 7YG4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF17098	Wtap	68 → 222	WTAP/Mum2p family	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:11001926}.

Sequence

MTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEE
KLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLF
FLKMKGELEQTKDKLEQAQNELSAWKFTPDSQTGKKLMAKCRMLIQENQELGRQLSQGRI
AQLEAELALQKKYSEELKSSQDELNDFIIQLDEEVEGMQSTILVLQQQLKETRQQLAQYQ
QQQSQASAPSTSRTTASEPVEQSEATSKDCSRLTNGPSNGSSSRQRTSGSGFHREGNTTE
DDFPSSPGNGNKSSNSSEERTGRGGSGYVNQLSAGYESVDSPTGSENSLTHQSNDTDSSH
DPQEEKAVSGKGNRTVGSRHVQNGLDSSVNVQGSVL

Sequence length

396

Interactions

View interactions

	Reactome
			Processing of Capped Intron-Containing Pre-mRNA

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ESOPHAGEAL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL ULCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (69)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	33725886	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	30143009		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28454430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	36541909	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	40225569	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	35211628	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30143009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30546429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	32281240	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30953473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34349094	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35046505	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32814762, 32967010, 34999731, 38077434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34221187, 34634995, 37227531	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30546429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	38286802	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34326314, 34595849, 38164857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	35211628	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	23354623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	35143566	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26071132, 35143566, 36849408	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29482572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	36595818	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30137347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	37986381	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	30143009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	33237039	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	36855123	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	34054840	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22957919, 27370540, 28212562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22957919, 27370540, 28212562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	27370540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	39689341	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	37589705	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	LHGDN	14675924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35733918	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	35304463	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformations	Intracranial arteriovenous malformation	Pubtator	32281240	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	34595849	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	30038300	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	28454430, 30038300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31438961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	32685056	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	35046505	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	27370540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30953473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31438961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30851419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30546429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22957919, 27430156, 28454430, 30143009, 30851419, 30953473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	36177774, 37558663	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	34999731	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27430156, 28454430, 29482572, 31438961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	32176634	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29866655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	34950106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	36967763	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	32814762, 35356854	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32951457, 32998774, 35733918, 36545327, 37272931, 37684273	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30851419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	28454430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33625109, 37591781	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	35650605	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29482572		★★★★★ ★☆☆☆☆ Found in Text Mining only
SMITH-MCCORT DYSPLASIA 1	Smith-McCort Dysplasia	BEFREE	17095724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32176425	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	34650160	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35046505	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	35806168, 37474926	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

WTAP (WT1 associated protein)