KIF20B (kinesin family member 20B)

Gene

• Entrez ID: 9585
• Gene name: Kinesin family member 20B
• Gene symbol: KIF20B
• Synonyms (NCBI Gene): CT90, KRMP1, MPHOSPH1, MPP-1, MPP1
• Chromosome: 10
• Chromosome location: 10q23.31

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004856	hsa-miR-192-5p	Luciferase reporter assay, qRT-PCR	19074876
MIRT024937	hsa-miR-215-5p	Microarray	19074876
MIRT004856	hsa-miR-192-5p	Reporter assay;Microarray	19074876
MIRT044898	hsa-miR-188-5p	CLASH	23622248
MIRT1094003	hsa-miR-1193	CLIP-seq
MIRT1094004	hsa-miR-1225-5p	CLIP-seq
MIRT1094005	hsa-miR-1323	CLIP-seq
MIRT1094006	hsa-miR-186	CLIP-seq
MIRT1094007	hsa-miR-1909	CLIP-seq
MIRT1094008	hsa-miR-342-3p	CLIP-seq
MIRT1094009	hsa-miR-3689d	CLIP-seq
MIRT1094010	hsa-miR-4450	CLIP-seq
MIRT1094011	hsa-miR-4506	CLIP-seq
MIRT1094012	hsa-miR-4662a-3p	CLIP-seq
MIRT1094013	hsa-miR-4666-5p	CLIP-seq
MIRT1094014	hsa-miR-4716-3p	CLIP-seq
MIRT1094015	hsa-miR-4723-5p	CLIP-seq
MIRT1094016	hsa-miR-491-5p	CLIP-seq
MIRT1094017	hsa-miR-548o	CLIP-seq
MIRT1094018	hsa-miR-569	CLIP-seq
MIRT1094019	hsa-miR-577	CLIP-seq
MIRT1094020	hsa-miR-592	CLIP-seq
MIRT1094021	hsa-miR-597	CLIP-seq
MIRT2025200	hsa-miR-1273e	CLIP-seq
MIRT2025201	hsa-miR-190	CLIP-seq
MIRT2025202	hsa-miR-190b	CLIP-seq
MIRT2025203	hsa-miR-3134	CLIP-seq
MIRT2025204	hsa-miR-3148	CLIP-seq
MIRT2025205	hsa-miR-3184	CLIP-seq
MIRT2025206	hsa-miR-380	CLIP-seq
MIRT2025207	hsa-miR-423-5p	CLIP-seq
MIRT2025208	hsa-miR-4495	CLIP-seq
MIRT2025209	hsa-miR-4760-3p	CLIP-seq
MIRT2025210	hsa-miR-4777-3p	CLIP-seq
MIRT2025211	hsa-miR-515-5p	CLIP-seq
MIRT2025212	hsa-miR-568	CLIP-seq
MIRT2025213	hsa-miR-875-5p	CLIP-seq
MIRT2025200	hsa-miR-1273e	CLIP-seq
MIRT2025203	hsa-miR-3134	CLIP-seq
MIRT2025204	hsa-miR-3148	CLIP-seq
MIRT2025205	hsa-miR-3184	CLIP-seq
MIRT2025207	hsa-miR-423-5p	CLIP-seq
MIRT2025209	hsa-miR-4760-3p	CLIP-seq
MIRT2025210	hsa-miR-4777-3p	CLIP-seq
MIRT2025213	hsa-miR-875-5p	CLIP-seq
MIRT2025200	hsa-miR-1273e	CLIP-seq
MIRT2025203	hsa-miR-3134	CLIP-seq
MIRT2025205	hsa-miR-3184	CLIP-seq
MIRT2025207	hsa-miR-423-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000922	Component	Spindle pole	IEA
GO:0001843	Process	Neural tube closure	IEA
GO:0003777	Function	Microtubule motor activity	IBA
GO:0003777	Function	Microtubule motor activity	IEA
GO:0005515	Function	Protein binding	IPI	17409436
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	12740395, 17409436
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	11470801
GO:0005654	Component	Nucleoplasm	IEA
GO:0005730	Component	Nucleolus	IDA	11470801
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	8885239
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	11470801
GO:0005813	Component	Centrosome	IEA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005871	Component	Kinesin complex	IBA
GO:0005874	Component	Microtubule	IBA
GO:0005874	Component	Microtubule	IEA
GO:0007018	Process	Microtubule-based movement	IBA
GO:0007018	Process	Microtubule-based movement	IEA
GO:0007088	Process	Regulation of mitotic nuclear division	NAS	11470801
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IDA	12740395
GO:0008017	Function	Microtubule binding	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	12740395, 17409436
GO:0008284	Process	Positive regulation of cell population proliferation	ISS
GO:0008574	Function	Plus-end-directed microtubule motor activity	IDA	12740395
GO:0015630	Component	Microtubule cytoskeleton	IEA
GO:0016887	Function	ATP hydrolysis activity	IBA
GO:0016887	Function	ATP hydrolysis activity	IDA	11470801, 12740395
GO:0030424	Component	Axon	IEA
GO:0030426	Component	Growth cone	IEA
GO:0030496	Component	Midbody	IDA	12740395, 17409436
GO:0030496	Component	Midbody	IEA
GO:0030496	Component	Midbody	ISS
GO:0032467	Process	Positive regulation of cytokinesis	IMP	12740395
GO:0035372	Process	Protein localization to microtubule	IEA
GO:0035372	Process	Protein localization to microtubule	ISS
GO:0036064	Component	Ciliary basal body	IDA
GO:0042803	Function	Protein homodimerization activity	IDA	11470801
GO:0042995	Component	Cell projection	IEA
GO:0045171	Component	Intercellular bridge	IDA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0048812	Process	Neuron projection morphogenesis	IEA
GO:0048812	Process	Neuron projection morphogenesis	ISS
GO:0050699	Function	WW domain binding	IPI	11470801
GO:0051233	Component	Spindle midzone	IEA
GO:0051233	Component	Spindle midzone	ISS
GO:0051301	Process	Cell division	IEA
GO:0051726	Process	Regulation of cell cycle	NAS	11470801
GO:0070201	Process	Regulation of establishment of protein localization	IEA
GO:0070938	Component	Contractile ring	IDA	17409436
GO:0090316	Process	Positive regulation of intracellular protein transport	IEA
GO:0090316	Process	Positive regulation of intracellular protein transport	ISS
GO:0097431	Component	Mitotic spindle pole	IDA	11470801
GO:1903438	Process	Positive regulation of mitotic cytokinetic process	IEA
GO:1903438	Process	Positive regulation of mitotic cytokinetic process	ISS
GO:1990023	Component	Mitotic spindle midzone	IDA	12740395
GO:2000114	Process	Regulation of establishment of cell polarity	IEA
GO:2000114	Process	Regulation of establishment of cell polarity	ISS
GO:2001222	Process	Regulation of neuron migration	IEA
GO:2001224	Process	Positive regulation of neuron migration	IEA
GO:2001224	Process	Positive regulation of neuron migration	ISS

Other IDs

• MIM: 605498
• HGNC: 7212
• e!Ensembl: ENSG00000138182

Protein

• UniProt ID: Q96Q89
• Protein name: Kinesin-like protein KIF20B (Cancer/testis antigen 90) (CT90) (Kinesin family member 20B) (Kinesin-related motor interacting with PIN1) (M-phase phosphoprotein 1) (MPP1)
• Protein function: Plus-end-directed motor enzyme that is required for completion of cytokinesis (PubMed:11470801, PubMed:12740395). Required for proper midbody organization and abscission in polarized cortical stem cells. Plays a role in the regulation of neurona
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00225	Kinesin	64 → 479	Kinesin motor domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Brain, ovary, kidney and testis (at protein level) (PubMed:12740395). Overexpressed in bladder cancer cells (at protein level) (PubMed:17409436). Expressed in testis. Overexpressed in bladder cancer cells (PubMed:17409436). {ECO:000026
• Sequence:

  MESNFNQEGVPRPSYVFSADPIARPSEINFDGIKLDLSHEFSLVAPNTEANSFESKDYLQ
  VCLRIRPFTQSEKELESEGCVHILDSQTVVLKEPQCILGRLSEKSSGQMAQKFSFSKVFG
  PATTQKEFFQGCIMQPVKDLLKGQSRLIFTYGLTNSGKTYTFQGTEENIGILPRTLNVLF
  DSLQERLYTKMNLKPHRSREYLRLSSEQEKEEIASKSALLRQIKEVTVHNDSDDTLYGSL
  TNSLNISEFEESIKDYEQANLNMANSIKFSVWVSFFEIYNEYIYDLFVPVSSKFQKRKML
  RLSQDVKGYSFIKDLQWIQVSDSKEAYRLLKLGIKHQSVAFTKLNNASSRSHSIFTVKIL
  QIEDSEMSRVIRVSELSLCDLAGSERTMKTQNEGERLRETGNINTSLLTLGKCINVLKNS
  EKSKFQQHVPFRESKLTHYFQSFFNGKGKICMIVNISQCYLAYDETLNVLKFSAIAQKVC
  VPDTLNSSQEKLFGPVKSSQDVSLDSNSNSKILNVKRATISWENSLEDLMEDEDLVEELE
  NAEETQNVETKLLDEDLDKTLEENKAFISHEEKRKLLDLIEDLKKKLINEKKEKLTLEFK
  IREEVTQEFTQYWAQREADFKETLLQEREILEENAERRLAIFKDLVGKCDTREEAAKDIC
  ATKVETEETHNYVGFEDIIDSLQDNVADIKKQAEIAHLYIASLPDPQEATACLELKFNQI
  KAELAKTKGELIKTKEELKKRENESDSLIQELETSNKKIITQNQRIKELINIIDQKEDTI
  NEFQNLKSHMENTFKCNDKADTSSLIINNKLICNETVEVPKDSKSKICSERKRVNENELQ
  QDEPPAKKGSIHVSSAITEDQKKSEEVRPNIAEIEDIRVLQENNEGLRAFLLTIENELKN
  EKEEKAELNKQIVHFQQELSLSEKKNLTLSKEVQQIQSNYDIAIAELHVQKSKNQEQEEK
  IMKLSNEIETATRSITNNVSQIKLMHTKIDELRTLDSVSQISNIDLLNLRDLSNGSEEDN
  LPNTQLDLLGNDYLVSKQVKEYRIQEPNRENSFHSSIEAIWEECKEIVKASSKKSHQIEE
  LEQQIEKLQAEVKGYKDENNRLKEKEHKNQDDLLKEKETLIQQLKEELQEKNVTLDVQIQ
  HVVEGKRALSELTQGVTCYKAKIKELETILETQKVECSHSAKLEQDILEKESIILKLERN
  LKEFQEHLQDSVKNTKDLNVKELKLKEEITQLTNNLQDMKHLLQLKEEEEETNRQETEKL
  KEELSASSARTQNLKADLQRKEEDYADLKEKLTDAKKQIKQVQKEVSVMRDEDKLLRIKI
  NELEKKKNQCSQELDMKQRTIQQLKEQLNNQKVEEAIQQYERACKDLNVKEKIIEDMRMT
  LEEQEQTQVEQDQVLEAKLEEVERLATELEKWKEKCNDLETKNNQRSNKEHENNTDVLGK
  LTNLQDELQESEQKYNADRKKWLEEKMMLITQAKEAENIRNKEMKKYAEDRERFFKQQNE
  MEILTAQLTEKDSDLQKWREERDQLVAALEIQLKALISSNVQKDNEIEQLKRIISETSKI
  ETQIMDIKPKRISSADPDKLQTEPLSTSFEISRNKIEDGSVVLDSCEVSTENDQSTRFPK
  PELEIQFTPLQPNKMAVKHPGCTTPVTVKIPKARKRKSNEMEEDLVKCENKKNATPRTNL
  KFPISDDRNSSVKKEQKVAIRPSSKKTYSLRSQASIIGVNLATKKKEGTLQKFGDFLQHS
  PSILQSKAKKIIETMSSSKLSNVEASKENVSQPKRAKRKLYTSEISSPIDISGQVILMDQ
  KMKESDHQIIKRRLRTKTAK

• Sequence length: 1820

Pathways

KEGG:

Motor proteins

Reactome:

COPI-dependent Golgi-to-ER retrograde traffic
Kinesins

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY TRACT CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar GWAS catalog	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
HEPATOCELLULAR CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	2243505		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	29573464		★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	19914412	Associate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	29535371		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	16947419		★☆☆☆☆ Found in Text Mining only
Beta thalassemia intermedia	beta Thalassemia	BEFREE	29474985		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	17409436, 29632734, 29971464, 30805928		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	10071076		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16514421, 30805928		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30191636	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	17409436, 29632734, 29971464, 30805928		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	39237897	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	29573464		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	30805928		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29573464		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	40229707	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30805928		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	1320571		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	7926295		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31736881		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	32500232	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	11732005		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	7566386		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	7566386		★☆☆☆☆ Found in Text Mining only
Hereditary spherocytosis	Hereditary Spherocytosis	BEFREE	29474985		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	1691591		★☆☆☆☆ Found in Text Mining only
Leukemia, Large Granular Lymphocytic	Lymphoblastic Leukemia	BEFREE	1835747, 2146981		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29146910, 8445947		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	12149223		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25269478, 29573464, 30191636, 30519350		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	1472125		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	12716467	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16514421, 30805928		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	17901709, 29573464		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	30664160		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	17409436, 29632734, 29971464, 30805928		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10695267, 29573464, 30664160		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	28359322		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	29535371		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	10071076		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16514421, 21794078, 25269478, 30664160, 30805928, 31354888, 8387543		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	24947010		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	38169731	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	7933116		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	2243505		★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	30100206		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	30805928		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30805928		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	28243236		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10088772, 11953970, 1320571		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	3138285		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30664160		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	30519350		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	34065612	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	27998971		★☆☆☆☆ Found in Text Mining only