Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9575
Gene name	Clock circadian regulator
Gene symbol	CLOCK
Synonyms (NCBI Gene)	KAT13DbHLHe8
Chromosome	4
Chromosome location	4q12
Summary	The protein encoded by this gene plays a central role in the regulation of circadian rhythms. The protein encodes a transcription factor of the basic helix-loop-helix (bHLH) family and contains DNA binding histone acetyltransferase activity. The encoded p

690

Show/Hide all (690)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002951	hsa-miR-141-3p	Northern blotqRT-PCRWestern blot	16762633
MIRT005358	hsa-miR-182-5p	Luciferase reporter assayqRT-PCR	20656788
MIRT002951	hsa-miR-141-3p	Luciferase reporter assay	15131085
MIRT020471	hsa-miR-106b-5p	Microarray	17242205
MIRT021546	hsa-miR-142-3p	Microarray	17612493
MIRT002951	hsa-miR-141-3p	Reporter assay	15131085
MIRT028847	hsa-miR-26b-5p	Microarray	19088304
MIRT030679	hsa-miR-21-5p	Microarray	18591254
MIRT053356	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	23792158
MIRT437643	hsa-miR-152-3p	MicroarrayqRT-PCR	22815788
MIRT437741	hsa-miR-34a-5p	MicroarrayqRT-PCR	22815788
MIRT613199	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT613192	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT613191	hsa-miR-7703	HITS-CLIP	23824327
MIRT613190	hsa-miR-4325	HITS-CLIP	23824327
MIRT613189	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT613188	hsa-miR-507	HITS-CLIP	23824327
MIRT613187	hsa-miR-557	HITS-CLIP	23824327
MIRT613199	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT613197	hsa-miR-548a-3p	HITS-CLIP	23824327
MIRT613196	hsa-miR-548ar-3p	HITS-CLIP	23824327
MIRT613195	hsa-miR-548az-3p	HITS-CLIP	23824327
MIRT613194	hsa-miR-548e-3p	HITS-CLIP	23824327
MIRT613193	hsa-miR-548f-3p	HITS-CLIP	23824327
MIRT613192	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT613191	hsa-miR-7703	HITS-CLIP	23824327
MIRT613190	hsa-miR-4325	HITS-CLIP	23824327
MIRT613189	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT613188	hsa-miR-507	HITS-CLIP	23824327
MIRT613187	hsa-miR-557	HITS-CLIP	23824327
MIRT613186	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT613199	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT613192	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT613191	hsa-miR-7703	HITS-CLIP	23824327
MIRT613190	hsa-miR-4325	HITS-CLIP	23824327
MIRT613189	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT613188	hsa-miR-507	HITS-CLIP	23824327
MIRT613187	hsa-miR-557	HITS-CLIP	23824327
MIRT613186	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT613199	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT613192	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT613191	hsa-miR-7703	HITS-CLIP	23824327
MIRT613190	hsa-miR-4325	HITS-CLIP	23824327
MIRT613189	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT613188	hsa-miR-507	HITS-CLIP	23824327
MIRT613187	hsa-miR-557	HITS-CLIP	23824327
MIRT613186	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT613199	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT613197	hsa-miR-548a-3p	HITS-CLIP	23824327
MIRT613196	hsa-miR-548ar-3p	HITS-CLIP	23824327
MIRT613195	hsa-miR-548az-3p	HITS-CLIP	23824327
MIRT613194	hsa-miR-548e-3p	HITS-CLIP	23824327
MIRT613193	hsa-miR-548f-3p	HITS-CLIP	23824327
MIRT613192	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT613191	hsa-miR-7703	HITS-CLIP	23824327
MIRT613190	hsa-miR-4325	HITS-CLIP	23824327
MIRT613189	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT613188	hsa-miR-507	HITS-CLIP	23824327
MIRT613187	hsa-miR-557	HITS-CLIP	23824327
MIRT613186	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT613199	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT613197	hsa-miR-548a-3p	HITS-CLIP	23824327
MIRT613196	hsa-miR-548ar-3p	HITS-CLIP	23824327
MIRT613195	hsa-miR-548az-3p	HITS-CLIP	23824327
MIRT613194	hsa-miR-548e-3p	HITS-CLIP	23824327
MIRT613193	hsa-miR-548f-3p	HITS-CLIP	23824327
MIRT613192	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT613191	hsa-miR-7703	HITS-CLIP	23824327
MIRT613190	hsa-miR-4325	HITS-CLIP	23824327
MIRT613189	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT613188	hsa-miR-507	HITS-CLIP	23824327
MIRT613187	hsa-miR-557	HITS-CLIP	23824327
MIRT613186	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT613199	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT613197	hsa-miR-548a-3p	HITS-CLIP	23824327
MIRT613196	hsa-miR-548ar-3p	HITS-CLIP	23824327
MIRT613195	hsa-miR-548az-3p	HITS-CLIP	23824327
MIRT613194	hsa-miR-548e-3p	HITS-CLIP	23824327
MIRT613193	hsa-miR-548f-3p	HITS-CLIP	23824327
MIRT613192	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT613191	hsa-miR-7703	HITS-CLIP	23824327
MIRT613190	hsa-miR-4325	HITS-CLIP	23824327
MIRT613189	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT613188	hsa-miR-507	HITS-CLIP	23824327
MIRT613187	hsa-miR-557	HITS-CLIP	23824327
MIRT613186	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT538503	hsa-miR-19b-3p	PAR-CLIP	22012620
MIRT538502	hsa-miR-19a-3p	PAR-CLIP	22012620
MIRT538501	hsa-miR-548az-5p	PAR-CLIP	22012620
MIRT538500	hsa-miR-548t-5p	PAR-CLIP	22012620
MIRT538499	hsa-miR-33b-3p	PAR-CLIP	22012620
MIRT538498	hsa-miR-515-3p	PAR-CLIP	22012620
MIRT538497	hsa-miR-519e-3p	PAR-CLIP	22012620
MIRT538496	hsa-miR-4461	PAR-CLIP	22012620
MIRT538495	hsa-miR-580-3p	PAR-CLIP	22012620
MIRT538494	hsa-miR-6818-5p	PAR-CLIP	22012620
MIRT538493	hsa-miR-147a	PAR-CLIP	22012620
MIRT538492	hsa-miR-2113	PAR-CLIP	22012620
MIRT538491	hsa-miR-5010-3p	PAR-CLIP	22012620
MIRT538490	hsa-miR-3129-3p	PAR-CLIP	22012620
MIRT538489	hsa-miR-5583-5p	PAR-CLIP	22012620
MIRT538488	hsa-miR-302b-5p	PAR-CLIP	22012620
MIRT538487	hsa-miR-302d-5p	PAR-CLIP	22012620
MIRT538486	hsa-miR-1290	PAR-CLIP	22012620
MIRT538485	hsa-miR-450b-3p	PAR-CLIP	22012620
MIRT538484	hsa-miR-769-3p	PAR-CLIP	22012620
MIRT538483	hsa-miR-6728-5p	PAR-CLIP	22012620
MIRT538482	hsa-miR-5089-5p	PAR-CLIP	22012620
MIRT538481	hsa-miR-450a-1-3p	PAR-CLIP	22012620
MIRT538480	hsa-miR-3122	PAR-CLIP	22012620
MIRT538479	hsa-miR-3913-5p	PAR-CLIP	22012620
MIRT538478	hsa-miR-887-5p	PAR-CLIP	22012620
MIRT538477	hsa-miR-6513-5p	PAR-CLIP	22012620
MIRT538476	hsa-miR-552-5p	PAR-CLIP	22012620
MIRT495893	hsa-miR-5582-5p	PAR-CLIP	22291592
MIRT495892	hsa-miR-3622a-5p	PAR-CLIP	22291592
MIRT495891	hsa-miR-3929	PAR-CLIP	22291592
MIRT495890	hsa-miR-4419b	PAR-CLIP	22291592
MIRT495889	hsa-miR-4478	PAR-CLIP	22291592
MIRT495888	hsa-miR-6826-5p	PAR-CLIP	22291592
MIRT495887	hsa-miR-4423-3p	PAR-CLIP	22291592
MIRT448902	hsa-miR-5571-5p	PAR-CLIP	22100165
MIRT448900	hsa-miR-4635	PAR-CLIP	22100165
MIRT448899	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT448898	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT020471	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT440933	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT020471	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT727975	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT727973	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT727974	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT727972	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT538502	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT538503	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT440933	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT727975	hsa-miR-17-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	27440219
MIRT727975	hsa-miR-17-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	27440219
MIRT727975	hsa-miR-17-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	27440219
MIRT727975	hsa-miR-17-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	27440219
MIRT538503	hsa-miR-19b-3p	Luciferase reporter assayRNA-seqqRT-PCR	31569141
MIRT613199	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT613192	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT613191	hsa-miR-7703	HITS-CLIP	23824327
MIRT613190	hsa-miR-4325	HITS-CLIP	23824327
MIRT613189	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT613188	hsa-miR-507	HITS-CLIP	23824327
MIRT613187	hsa-miR-557	HITS-CLIP	23824327
MIRT613199	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT613197	hsa-miR-548a-3p	HITS-CLIP	23824327
MIRT613196	hsa-miR-548ar-3p	HITS-CLIP	23824327
MIRT613195	hsa-miR-548az-3p	HITS-CLIP	23824327
MIRT613194	hsa-miR-548e-3p	HITS-CLIP	23824327
MIRT613193	hsa-miR-548f-3p	HITS-CLIP	23824327
MIRT613192	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT613191	hsa-miR-7703	HITS-CLIP	23824327
MIRT613190	hsa-miR-4325	HITS-CLIP	23824327
MIRT613189	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT613188	hsa-miR-507	HITS-CLIP	23824327
MIRT613187	hsa-miR-557	HITS-CLIP	23824327
MIRT613186	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT613199	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT613192	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT613191	hsa-miR-7703	HITS-CLIP	23824327
MIRT613190	hsa-miR-4325	HITS-CLIP	23824327
MIRT613189	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT613188	hsa-miR-507	HITS-CLIP	23824327
MIRT613187	hsa-miR-557	HITS-CLIP	23824327
MIRT613186	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT613199	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT613192	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT613191	hsa-miR-7703	HITS-CLIP	23824327
MIRT613190	hsa-miR-4325	HITS-CLIP	23824327
MIRT613189	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT613188	hsa-miR-507	HITS-CLIP	23824327
MIRT613187	hsa-miR-557	HITS-CLIP	23824327
MIRT613186	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT613199	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT613197	hsa-miR-548a-3p	HITS-CLIP	23824327
MIRT613196	hsa-miR-548ar-3p	HITS-CLIP	23824327
MIRT613195	hsa-miR-548az-3p	HITS-CLIP	23824327
MIRT613194	hsa-miR-548e-3p	HITS-CLIP	23824327
MIRT613193	hsa-miR-548f-3p	HITS-CLIP	23824327
MIRT613192	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT613191	hsa-miR-7703	HITS-CLIP	23824327
MIRT613190	hsa-miR-4325	HITS-CLIP	23824327
MIRT613189	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT613188	hsa-miR-507	HITS-CLIP	23824327
MIRT613187	hsa-miR-557	HITS-CLIP	23824327
MIRT613186	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT613199	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT613197	hsa-miR-548a-3p	HITS-CLIP	23824327
MIRT613196	hsa-miR-548ar-3p	HITS-CLIP	23824327
MIRT613195	hsa-miR-548az-3p	HITS-CLIP	23824327
MIRT613194	hsa-miR-548e-3p	HITS-CLIP	23824327
MIRT613193	hsa-miR-548f-3p	HITS-CLIP	23824327
MIRT613192	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT613191	hsa-miR-7703	HITS-CLIP	23824327
MIRT613190	hsa-miR-4325	HITS-CLIP	23824327
MIRT613189	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT613188	hsa-miR-507	HITS-CLIP	23824327
MIRT613187	hsa-miR-557	HITS-CLIP	23824327
MIRT613186	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT613199	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT613197	hsa-miR-548a-3p	HITS-CLIP	23824327
MIRT613196	hsa-miR-548ar-3p	HITS-CLIP	23824327
MIRT613195	hsa-miR-548az-3p	HITS-CLIP	23824327
MIRT613194	hsa-miR-548e-3p	HITS-CLIP	23824327
MIRT613193	hsa-miR-548f-3p	HITS-CLIP	23824327
MIRT613192	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT613191	hsa-miR-7703	HITS-CLIP	23824327
MIRT613190	hsa-miR-4325	HITS-CLIP	23824327
MIRT613189	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT613188	hsa-miR-507	HITS-CLIP	23824327
MIRT613187	hsa-miR-557	HITS-CLIP	23824327
MIRT613186	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT538503	hsa-miR-19b-3p	PAR-CLIP	22012620
MIRT538502	hsa-miR-19a-3p	PAR-CLIP	22012620
MIRT538501	hsa-miR-548az-5p	PAR-CLIP	22012620
MIRT538500	hsa-miR-548t-5p	PAR-CLIP	22012620
MIRT538499	hsa-miR-33b-3p	PAR-CLIP	22012620
MIRT538498	hsa-miR-515-3p	PAR-CLIP	22012620
MIRT538497	hsa-miR-519e-3p	PAR-CLIP	22012620
MIRT538496	hsa-miR-4461	PAR-CLIP	22012620
MIRT538495	hsa-miR-580-3p	PAR-CLIP	22012620
MIRT538494	hsa-miR-6818-5p	PAR-CLIP	22012620
MIRT538493	hsa-miR-147a	PAR-CLIP	22012620
MIRT538492	hsa-miR-2113	PAR-CLIP	22012620
MIRT538491	hsa-miR-5010-3p	PAR-CLIP	22012620
MIRT538490	hsa-miR-3129-3p	PAR-CLIP	22012620
MIRT538489	hsa-miR-5583-5p	PAR-CLIP	22012620
MIRT538488	hsa-miR-302b-5p	PAR-CLIP	22012620
MIRT538487	hsa-miR-302d-5p	PAR-CLIP	22012620
MIRT538486	hsa-miR-1290	PAR-CLIP	22012620
MIRT538485	hsa-miR-450b-3p	PAR-CLIP	22012620
MIRT538484	hsa-miR-769-3p	PAR-CLIP	22012620
MIRT538483	hsa-miR-6728-5p	PAR-CLIP	22012620
MIRT538482	hsa-miR-5089-5p	PAR-CLIP	22012620
MIRT538481	hsa-miR-450a-1-3p	PAR-CLIP	22012620
MIRT538480	hsa-miR-3122	PAR-CLIP	22012620
MIRT538479	hsa-miR-3913-5p	PAR-CLIP	22012620
MIRT538478	hsa-miR-887-5p	PAR-CLIP	22012620
MIRT538477	hsa-miR-6513-5p	PAR-CLIP	22012620
MIRT538476	hsa-miR-552-5p	PAR-CLIP	22012620
MIRT495893	hsa-miR-5582-5p	PAR-CLIP	22291592
MIRT495892	hsa-miR-3622a-5p	PAR-CLIP	22291592
MIRT495891	hsa-miR-3929	PAR-CLIP	22291592
MIRT495890	hsa-miR-4419b	PAR-CLIP	22291592
MIRT495889	hsa-miR-4478	PAR-CLIP	22291592
MIRT495888	hsa-miR-6826-5p	PAR-CLIP	22291592
MIRT495887	hsa-miR-4423-3p	PAR-CLIP	22291592
MIRT448902	hsa-miR-5571-5p	PAR-CLIP	22100165
MIRT448900	hsa-miR-4635	PAR-CLIP	22100165
MIRT448899	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT448898	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT437741	hsa-miR-34a-5p	Luciferase reporter assayWestern blottingqRT-PCR	37561715
MIRT897554	hsa-miR-1	CLIP-seq
MIRT897555	hsa-miR-1193	CLIP-seq
MIRT897556	hsa-miR-1208	CLIP-seq
MIRT897557	hsa-miR-1236	CLIP-seq
MIRT897558	hsa-miR-124	CLIP-seq
MIRT897559	hsa-miR-1243	CLIP-seq
MIRT897560	hsa-miR-1252	CLIP-seq
MIRT897561	hsa-miR-1253	CLIP-seq
MIRT897562	hsa-miR-1304	CLIP-seq
MIRT897563	hsa-miR-1323	CLIP-seq
MIRT897564	hsa-miR-154	CLIP-seq
MIRT897565	hsa-miR-206	CLIP-seq
MIRT897566	hsa-miR-216b	CLIP-seq
MIRT897567	hsa-miR-23a	CLIP-seq
MIRT897568	hsa-miR-23b	CLIP-seq
MIRT897569	hsa-miR-23c	CLIP-seq
MIRT897570	hsa-miR-299-3p	CLIP-seq
MIRT897571	hsa-miR-3140-5p	CLIP-seq
MIRT897572	hsa-miR-3145-3p	CLIP-seq
MIRT897573	hsa-miR-3153	CLIP-seq
MIRT897574	hsa-miR-3170	CLIP-seq
MIRT897575	hsa-miR-3175	CLIP-seq
MIRT897576	hsa-miR-3611	CLIP-seq
MIRT897577	hsa-miR-3622a-3p	CLIP-seq
MIRT897578	hsa-miR-3622b-3p	CLIP-seq
MIRT897579	hsa-miR-3654	CLIP-seq
MIRT897580	hsa-miR-3675-3p	CLIP-seq
MIRT897581	hsa-miR-3675-5p	CLIP-seq
MIRT897582	hsa-miR-3687	CLIP-seq
MIRT897583	hsa-miR-371-3p	CLIP-seq
MIRT897584	hsa-miR-371b-3p	CLIP-seq
MIRT897585	hsa-miR-376c	CLIP-seq
MIRT897586	hsa-miR-3908	CLIP-seq
MIRT897587	hsa-miR-3922-5p	CLIP-seq
MIRT897588	hsa-miR-3942-5p	CLIP-seq
MIRT897589	hsa-miR-4424	CLIP-seq
MIRT897590	hsa-miR-4426	CLIP-seq
MIRT897591	hsa-miR-4434	CLIP-seq
MIRT897592	hsa-miR-4436b-5p	CLIP-seq
MIRT897593	hsa-miR-4442	CLIP-seq
MIRT897594	hsa-miR-4473	CLIP-seq
MIRT897595	hsa-miR-4516	CLIP-seq
MIRT897596	hsa-miR-4528	CLIP-seq
MIRT897597	hsa-miR-4637	CLIP-seq
MIRT897598	hsa-miR-4642	CLIP-seq
MIRT897599	hsa-miR-4647	CLIP-seq
MIRT897600	hsa-miR-4648	CLIP-seq
MIRT897601	hsa-miR-4652-3p	CLIP-seq
MIRT897602	hsa-miR-4654	CLIP-seq
MIRT897603	hsa-miR-4661-3p	CLIP-seq
MIRT897604	hsa-miR-4662b	CLIP-seq
MIRT897605	hsa-miR-4668-3p	CLIP-seq
MIRT897606	hsa-miR-4668-5p	CLIP-seq
MIRT897607	hsa-miR-4671-3p	CLIP-seq
MIRT897608	hsa-miR-4680-3p	CLIP-seq
MIRT897609	hsa-miR-4684-5p	CLIP-seq
MIRT897610	hsa-miR-4703-5p	CLIP-seq
MIRT897611	hsa-miR-4710	CLIP-seq
MIRT897612	hsa-miR-4729	CLIP-seq
MIRT897613	hsa-miR-4762-3p	CLIP-seq
MIRT897614	hsa-miR-4766-3p	CLIP-seq
MIRT897615	hsa-miR-4769-5p	CLIP-seq
MIRT897616	hsa-miR-4792	CLIP-seq
MIRT897617	hsa-miR-488	CLIP-seq
MIRT897618	hsa-miR-499-3p	CLIP-seq
MIRT897619	hsa-miR-499a-3p	CLIP-seq
MIRT897620	hsa-miR-506	CLIP-seq
MIRT897621	hsa-miR-519e	CLIP-seq
MIRT897622	hsa-miR-544	CLIP-seq
MIRT897623	hsa-miR-548e	CLIP-seq
MIRT897624	hsa-miR-548f	CLIP-seq
MIRT897625	hsa-miR-548m	CLIP-seq
MIRT897626	hsa-miR-548n	CLIP-seq
MIRT897627	hsa-miR-548o	CLIP-seq
MIRT897628	hsa-miR-548t	CLIP-seq
MIRT897629	hsa-miR-556-3p	CLIP-seq
MIRT897630	hsa-miR-607	CLIP-seq
MIRT897631	hsa-miR-613	CLIP-seq
MIRT897632	hsa-miR-617	CLIP-seq
MIRT897633	hsa-miR-651	CLIP-seq
MIRT897634	hsa-miR-664	CLIP-seq
MIRT1546509	hsa-miR-141	CLIP-seq
MIRT1546510	hsa-miR-194	CLIP-seq
MIRT1546511	hsa-miR-200a	CLIP-seq
MIRT1546512	hsa-miR-34a	CLIP-seq
MIRT1546513	hsa-miR-34c-5p	CLIP-seq
MIRT1546514	hsa-miR-3607-3p	CLIP-seq
MIRT1546515	hsa-miR-3686	CLIP-seq
MIRT1546516	hsa-miR-3909	CLIP-seq
MIRT1546517	hsa-miR-449a	CLIP-seq
MIRT1546518	hsa-miR-449b	CLIP-seq
MIRT897585	hsa-miR-376c	CLIP-seq
MIRT897618	hsa-miR-499-3p	CLIP-seq
MIRT897619	hsa-miR-499a-3p	CLIP-seq
MIRT897585	hsa-miR-376c	CLIP-seq
MIRT897618	hsa-miR-499-3p	CLIP-seq
MIRT897619	hsa-miR-499a-3p	CLIP-seq
MIRT1966132	hsa-miR-103a	CLIP-seq
MIRT1966133	hsa-miR-103b	CLIP-seq
MIRT1966134	hsa-miR-1178	CLIP-seq
MIRT1966135	hsa-miR-1184	CLIP-seq
MIRT1966136	hsa-miR-1205	CLIP-seq
MIRT1966137	hsa-miR-1228	CLIP-seq
MIRT897559	hsa-miR-1243	CLIP-seq
MIRT1966138	hsa-miR-1269	CLIP-seq
MIRT1966139	hsa-miR-1269b	CLIP-seq
MIRT1966140	hsa-miR-1288	CLIP-seq
MIRT897563	hsa-miR-1323	CLIP-seq
MIRT1966141	hsa-miR-18a	CLIP-seq
MIRT1966142	hsa-miR-18b	CLIP-seq
MIRT1966143	hsa-miR-19a	CLIP-seq
MIRT1966144	hsa-miR-19b	CLIP-seq
MIRT1966145	hsa-miR-2052	CLIP-seq
MIRT1966146	hsa-miR-298	CLIP-seq
MIRT1966147	hsa-miR-30a	CLIP-seq
MIRT1966148	hsa-miR-30b	CLIP-seq
MIRT1966149	hsa-miR-30c	CLIP-seq
MIRT1966150	hsa-miR-30d	CLIP-seq
MIRT1966151	hsa-miR-30e	CLIP-seq
MIRT1966152	hsa-miR-3117-5p	CLIP-seq
MIRT897571	hsa-miR-3140-5p	CLIP-seq
MIRT1966153	hsa-miR-3158-5p	CLIP-seq
MIRT1966154	hsa-miR-3200-5p	CLIP-seq
MIRT1966155	hsa-miR-342-3p	CLIP-seq
MIRT897577	hsa-miR-3622a-3p	CLIP-seq
MIRT897578	hsa-miR-3622b-3p	CLIP-seq
MIRT897579	hsa-miR-3654	CLIP-seq
MIRT897581	hsa-miR-3675-5p	CLIP-seq
MIRT897582	hsa-miR-3687	CLIP-seq
MIRT1966156	hsa-miR-3689d	CLIP-seq
MIRT1966157	hsa-miR-3691-3p	CLIP-seq
MIRT897583	hsa-miR-371-3p	CLIP-seq
MIRT897584	hsa-miR-371b-3p	CLIP-seq
MIRT1966158	hsa-miR-375	CLIP-seq
MIRT1966159	hsa-miR-376a	CLIP-seq
MIRT1966160	hsa-miR-376b	CLIP-seq
MIRT1966161	hsa-miR-378	CLIP-seq
MIRT1966162	hsa-miR-378b	CLIP-seq
MIRT1966163	hsa-miR-378c	CLIP-seq
MIRT1966164	hsa-miR-378d	CLIP-seq
MIRT1966165	hsa-miR-378e	CLIP-seq
MIRT1966166	hsa-miR-378f	CLIP-seq
MIRT1966167	hsa-miR-378h	CLIP-seq
MIRT1966168	hsa-miR-378i	CLIP-seq
MIRT1966169	hsa-miR-3907	CLIP-seq
MIRT1966170	hsa-miR-3920	CLIP-seq
MIRT897587	hsa-miR-3922-5p	CLIP-seq
MIRT1966171	hsa-miR-3938	CLIP-seq
MIRT1966172	hsa-miR-3973	CLIP-seq
MIRT1966173	hsa-miR-422a	CLIP-seq
MIRT1966174	hsa-miR-4254	CLIP-seq
MIRT1966175	hsa-miR-4273	CLIP-seq
MIRT1966176	hsa-miR-4292	CLIP-seq
MIRT1966177	hsa-miR-4307	CLIP-seq
MIRT1966178	hsa-miR-4308	CLIP-seq
MIRT1966179	hsa-miR-4310	CLIP-seq
MIRT1966180	hsa-miR-4315	CLIP-seq
MIRT897589	hsa-miR-4424	CLIP-seq
MIRT897590	hsa-miR-4426	CLIP-seq
MIRT897593	hsa-miR-4442	CLIP-seq
MIRT897594	hsa-miR-4473	CLIP-seq
MIRT1966181	hsa-miR-4515	CLIP-seq
MIRT897596	hsa-miR-4528	CLIP-seq
MIRT897597	hsa-miR-4637	CLIP-seq
MIRT897599	hsa-miR-4647	CLIP-seq
MIRT897604	hsa-miR-4662b	CLIP-seq
MIRT897605	hsa-miR-4668-3p	CLIP-seq
MIRT897607	hsa-miR-4671-3p	CLIP-seq
MIRT1966182	hsa-miR-4677-5p	CLIP-seq
MIRT897608	hsa-miR-4680-3p	CLIP-seq
MIRT897611	hsa-miR-4710	CLIP-seq
MIRT1966183	hsa-miR-4714-3p	CLIP-seq
MIRT1966184	hsa-miR-4735-3p	CLIP-seq
MIRT1966185	hsa-miR-4740-5p	CLIP-seq
MIRT897613	hsa-miR-4762-3p	CLIP-seq
MIRT1966186	hsa-miR-4766-5p	CLIP-seq
MIRT1966187	hsa-miR-4768-5p	CLIP-seq
MIRT897616	hsa-miR-4792	CLIP-seq
MIRT1966188	hsa-miR-500a	CLIP-seq
MIRT1966189	hsa-miR-505	CLIP-seq
MIRT897621	hsa-miR-519e	CLIP-seq
MIRT897622	hsa-miR-544	CLIP-seq
MIRT897623	hsa-miR-548e	CLIP-seq
MIRT897624	hsa-miR-548f	CLIP-seq
MIRT1966190	hsa-miR-548l	CLIP-seq
MIRT897625	hsa-miR-548m	CLIP-seq
MIRT897627	hsa-miR-548o	CLIP-seq
MIRT1966191	hsa-miR-605	CLIP-seq
MIRT897630	hsa-miR-607	CLIP-seq
MIRT897632	hsa-miR-617	CLIP-seq
MIRT1966192	hsa-miR-626	CLIP-seq
MIRT1966193	hsa-miR-670	CLIP-seq
MIRT1966194	hsa-miR-934	CLIP-seq
MIRT897554	hsa-miR-1	CLIP-seq
MIRT1966132	hsa-miR-103a	CLIP-seq
MIRT897556	hsa-miR-1208	CLIP-seq
MIRT1966137	hsa-miR-1228	CLIP-seq
MIRT897559	hsa-miR-1243	CLIP-seq
MIRT897563	hsa-miR-1323	CLIP-seq
MIRT1546509	hsa-miR-141	CLIP-seq
MIRT1546510	hsa-miR-194	CLIP-seq
MIRT1966143	hsa-miR-19a	CLIP-seq
MIRT1966144	hsa-miR-19b	CLIP-seq
MIRT1546511	hsa-miR-200a	CLIP-seq
MIRT2201936	hsa-miR-200b	CLIP-seq
MIRT2201937	hsa-miR-200c	CLIP-seq
MIRT1966145	hsa-miR-2052	CLIP-seq
MIRT897565	hsa-miR-206	CLIP-seq
MIRT2201938	hsa-miR-2682	CLIP-seq
MIRT897570	hsa-miR-299-3p	CLIP-seq
MIRT1966147	hsa-miR-30a	CLIP-seq
MIRT1966148	hsa-miR-30b	CLIP-seq
MIRT1966149	hsa-miR-30c	CLIP-seq
MIRT1966150	hsa-miR-30d	CLIP-seq
MIRT1966151	hsa-miR-30e	CLIP-seq
MIRT2201939	hsa-miR-3125	CLIP-seq
MIRT2201940	hsa-miR-3137	CLIP-seq
MIRT897572	hsa-miR-3145-3p	CLIP-seq
MIRT897573	hsa-miR-3153	CLIP-seq
MIRT1546512	hsa-miR-34a	CLIP-seq
MIRT1546513	hsa-miR-34c-5p	CLIP-seq
MIRT1546514	hsa-miR-3607-3p	CLIP-seq
MIRT2201941	hsa-miR-3613-3p	CLIP-seq
MIRT897579	hsa-miR-3654	CLIP-seq
MIRT1546515	hsa-miR-3686	CLIP-seq
MIRT897582	hsa-miR-3687	CLIP-seq
MIRT1546516	hsa-miR-3909	CLIP-seq
MIRT2201942	hsa-miR-3913-3p	CLIP-seq
MIRT2201943	hsa-miR-3916	CLIP-seq
MIRT2201944	hsa-miR-3928	CLIP-seq
MIRT1966172	hsa-miR-3973	CLIP-seq
MIRT2201945	hsa-miR-4257	CLIP-seq
MIRT2201946	hsa-miR-4269	CLIP-seq
MIRT2201947	hsa-miR-4274	CLIP-seq
MIRT2201948	hsa-miR-429	CLIP-seq
MIRT1966177	hsa-miR-4307	CLIP-seq
MIRT1966179	hsa-miR-4310	CLIP-seq
MIRT1966180	hsa-miR-4315	CLIP-seq
MIRT897590	hsa-miR-4426	CLIP-seq
MIRT897593	hsa-miR-4442	CLIP-seq
MIRT1546517	hsa-miR-449a	CLIP-seq
MIRT1546518	hsa-miR-449b	CLIP-seq
MIRT2201949	hsa-miR-449c	CLIP-seq
MIRT2201950	hsa-miR-4504	CLIP-seq
MIRT2201951	hsa-miR-4519	CLIP-seq
MIRT897598	hsa-miR-4642	CLIP-seq
MIRT2201952	hsa-miR-4645-5p	CLIP-seq
MIRT897599	hsa-miR-4647	CLIP-seq
MIRT897600	hsa-miR-4648	CLIP-seq
MIRT897602	hsa-miR-4654	CLIP-seq
MIRT897604	hsa-miR-4662b	CLIP-seq
MIRT897606	hsa-miR-4668-5p	CLIP-seq
MIRT2201953	hsa-miR-4673	CLIP-seq
MIRT2201954	hsa-miR-4727-5p	CLIP-seq
MIRT897613	hsa-miR-4762-3p	CLIP-seq
MIRT1966187	hsa-miR-4768-5p	CLIP-seq
MIRT2201955	hsa-miR-4769-3p	CLIP-seq
MIRT897615	hsa-miR-4769-5p	CLIP-seq
MIRT2201956	hsa-miR-4773	CLIP-seq
MIRT2201957	hsa-miR-4794	CLIP-seq
MIRT2201958	hsa-miR-489	CLIP-seq
MIRT2201959	hsa-miR-495	CLIP-seq
MIRT897618	hsa-miR-499-3p	CLIP-seq
MIRT897619	hsa-miR-499a-3p	CLIP-seq
MIRT2201960	hsa-miR-542-3p	CLIP-seq
MIRT897623	hsa-miR-548e	CLIP-seq
MIRT897624	hsa-miR-548f	CLIP-seq
MIRT2201961	hsa-miR-548g	CLIP-seq
MIRT1966190	hsa-miR-548l	CLIP-seq
MIRT897625	hsa-miR-548m	CLIP-seq
MIRT897627	hsa-miR-548o	CLIP-seq
MIRT897628	hsa-miR-548t	CLIP-seq
MIRT2201962	hsa-miR-587	CLIP-seq
MIRT897630	hsa-miR-607	CLIP-seq
MIRT897631	hsa-miR-613	CLIP-seq
MIRT897632	hsa-miR-617	CLIP-seq
MIRT897634	hsa-miR-664	CLIP-seq
MIRT2201963	hsa-miR-665	CLIP-seq
MIRT2201964	hsa-miR-873	CLIP-seq
MIRT2201965	hsa-miR-892b	CLIP-seq
MIRT2201966	hsa-miR-940	CLIP-seq
MIRT2386207	hsa-miR-1275	CLIP-seq
MIRT897563	hsa-miR-1323	CLIP-seq
MIRT2386208	hsa-miR-2392	CLIP-seq
MIRT1966147	hsa-miR-30a	CLIP-seq
MIRT1966148	hsa-miR-30b	CLIP-seq
MIRT1966149	hsa-miR-30c	CLIP-seq
MIRT1966150	hsa-miR-30d	CLIP-seq
MIRT1966151	hsa-miR-30e	CLIP-seq
MIRT2386209	hsa-miR-3134	CLIP-seq
MIRT2386210	hsa-miR-3148	CLIP-seq
MIRT1966154	hsa-miR-3200-5p	CLIP-seq
MIRT1546512	hsa-miR-34a	CLIP-seq
MIRT1546513	hsa-miR-34c-5p	CLIP-seq
MIRT2386211	hsa-miR-3613-5p	CLIP-seq
MIRT897582	hsa-miR-3687	CLIP-seq
MIRT1546516	hsa-miR-3909	CLIP-seq
MIRT897590	hsa-miR-4426	CLIP-seq
MIRT897593	hsa-miR-4442	CLIP-seq
MIRT1546517	hsa-miR-449a	CLIP-seq
MIRT1546518	hsa-miR-449b	CLIP-seq
MIRT2386212	hsa-miR-4525	CLIP-seq
MIRT897596	hsa-miR-4528	CLIP-seq
MIRT897599	hsa-miR-4647	CLIP-seq
MIRT897604	hsa-miR-4662b	CLIP-seq
MIRT2386213	hsa-miR-4665-5p	CLIP-seq
MIRT897611	hsa-miR-4710	CLIP-seq
MIRT2386214	hsa-miR-4723-5p	CLIP-seq
MIRT2386215	hsa-miR-4732-3p	CLIP-seq
MIRT1966186	hsa-miR-4766-5p	CLIP-seq
MIRT897616	hsa-miR-4792	CLIP-seq
MIRT897623	hsa-miR-548e	CLIP-seq
MIRT897624	hsa-miR-548f	CLIP-seq
MIRT897625	hsa-miR-548m	CLIP-seq
MIRT897627	hsa-miR-548o	CLIP-seq
MIRT897630	hsa-miR-607	CLIP-seq
MIRT897632	hsa-miR-617	CLIP-seq
MIRT2386216	hsa-miR-625	CLIP-seq
MIRT897556	hsa-miR-1208	CLIP-seq
MIRT2447211	hsa-miR-34c-3p	CLIP-seq
MIRT1966158	hsa-miR-375	CLIP-seq
MIRT1966175	hsa-miR-4273	CLIP-seq
MIRT1966182	hsa-miR-4677-5p	CLIP-seq
MIRT1966188	hsa-miR-500a	CLIP-seq
MIRT897554	hsa-miR-1	CLIP-seq
MIRT897555	hsa-miR-1193	CLIP-seq
MIRT897559	hsa-miR-1243	CLIP-seq
MIRT2505012	hsa-miR-1270	CLIP-seq
MIRT2505013	hsa-miR-1273f	CLIP-seq
MIRT2505014	hsa-miR-128	CLIP-seq
MIRT2505015	hsa-miR-190	CLIP-seq
MIRT2505016	hsa-miR-190b	CLIP-seq
MIRT2505017	hsa-miR-197	CLIP-seq
MIRT897565	hsa-miR-206	CLIP-seq
MIRT897566	hsa-miR-216b	CLIP-seq
MIRT2505018	hsa-miR-22	CLIP-seq
MIRT2505019	hsa-miR-27a	CLIP-seq
MIRT2505020	hsa-miR-27b	CLIP-seq
MIRT897570	hsa-miR-299-3p	CLIP-seq
MIRT2201939	hsa-miR-3125	CLIP-seq
MIRT897572	hsa-miR-3145-3p	CLIP-seq
MIRT897573	hsa-miR-3153	CLIP-seq
MIRT2505021	hsa-miR-3160-3p	CLIP-seq
MIRT2505022	hsa-miR-3168	CLIP-seq
MIRT2505023	hsa-miR-331-5p	CLIP-seq
MIRT1546512	hsa-miR-34a	CLIP-seq
MIRT2447211	hsa-miR-34c-3p	CLIP-seq
MIRT1546513	hsa-miR-34c-5p	CLIP-seq
MIRT1546514	hsa-miR-3607-3p	CLIP-seq
MIRT2505024	hsa-miR-3646	CLIP-seq
MIRT897579	hsa-miR-3654	CLIP-seq
MIRT2505025	hsa-miR-3668	CLIP-seq
MIRT897580	hsa-miR-3675-3p	CLIP-seq
MIRT1546515	hsa-miR-3686	CLIP-seq
MIRT2505026	hsa-miR-369-3p	CLIP-seq
MIRT2505027	hsa-miR-374a	CLIP-seq
MIRT2505028	hsa-miR-374b	CLIP-seq
MIRT897586	hsa-miR-3908	CLIP-seq
MIRT1546516	hsa-miR-3909	CLIP-seq
MIRT2201943	hsa-miR-3916	CLIP-seq
MIRT897588	hsa-miR-3942-5p	CLIP-seq
MIRT2505029	hsa-miR-4263	CLIP-seq
MIRT2505030	hsa-miR-4268	CLIP-seq
MIRT2505031	hsa-miR-4448	CLIP-seq
MIRT2505032	hsa-miR-4487	CLIP-seq
MIRT1546517	hsa-miR-449a	CLIP-seq
MIRT1546518	hsa-miR-449b	CLIP-seq
MIRT2505033	hsa-miR-4536	CLIP-seq
MIRT897600	hsa-miR-4648	CLIP-seq
MIRT2505034	hsa-miR-4650-5p	CLIP-seq
MIRT897602	hsa-miR-4654	CLIP-seq
MIRT897606	hsa-miR-4668-5p	CLIP-seq
MIRT2505035	hsa-miR-4678	CLIP-seq
MIRT2505036	hsa-miR-4683	CLIP-seq
MIRT897609	hsa-miR-4684-5p	CLIP-seq
MIRT897610	hsa-miR-4703-5p	CLIP-seq
MIRT897612	hsa-miR-4729	CLIP-seq
MIRT2505037	hsa-miR-4732-5p	CLIP-seq
MIRT2505038	hsa-miR-4752	CLIP-seq
MIRT897614	hsa-miR-4766-3p	CLIP-seq
MIRT897615	hsa-miR-4769-5p	CLIP-seq
MIRT2201956	hsa-miR-4773	CLIP-seq
MIRT2505039	hsa-miR-526b	CLIP-seq
MIRT2505040	hsa-miR-549	CLIP-seq
MIRT2505041	hsa-miR-556-5p	CLIP-seq
MIRT2505042	hsa-miR-558	CLIP-seq
MIRT2505043	hsa-miR-595	CLIP-seq
MIRT1966191	hsa-miR-605	CLIP-seq
MIRT897631	hsa-miR-613	CLIP-seq
MIRT2505044	hsa-miR-620	CLIP-seq
MIRT2505045	hsa-miR-633	CLIP-seq
MIRT2505046	hsa-miR-646	CLIP-seq
MIRT897634	hsa-miR-664	CLIP-seq
MIRT2505047	hsa-miR-877	CLIP-seq
MIRT897554	hsa-miR-1	CLIP-seq
MIRT897555	hsa-miR-1193	CLIP-seq
MIRT897559	hsa-miR-1243	CLIP-seq
MIRT2505014	hsa-miR-128	CLIP-seq
MIRT2505017	hsa-miR-197	CLIP-seq
MIRT897565	hsa-miR-206	CLIP-seq
MIRT897566	hsa-miR-216b	CLIP-seq
MIRT2505018	hsa-miR-22	CLIP-seq
MIRT2505019	hsa-miR-27a	CLIP-seq
MIRT2505020	hsa-miR-27b	CLIP-seq
MIRT897570	hsa-miR-299-3p	CLIP-seq
MIRT2201939	hsa-miR-3125	CLIP-seq
MIRT897572	hsa-miR-3145-3p	CLIP-seq
MIRT897573	hsa-miR-3153	CLIP-seq
MIRT2505022	hsa-miR-3168	CLIP-seq
MIRT897579	hsa-miR-3654	CLIP-seq
MIRT2505025	hsa-miR-3668	CLIP-seq
MIRT897580	hsa-miR-3675-3p	CLIP-seq
MIRT2505026	hsa-miR-369-3p	CLIP-seq
MIRT2505027	hsa-miR-374a	CLIP-seq
MIRT2505028	hsa-miR-374b	CLIP-seq
MIRT2201943	hsa-miR-3916	CLIP-seq
MIRT2505030	hsa-miR-4268	CLIP-seq
MIRT2505031	hsa-miR-4448	CLIP-seq
MIRT2505033	hsa-miR-4536	CLIP-seq
MIRT897600	hsa-miR-4648	CLIP-seq
MIRT2505034	hsa-miR-4650-5p	CLIP-seq
MIRT897602	hsa-miR-4654	CLIP-seq
MIRT897606	hsa-miR-4668-5p	CLIP-seq
MIRT897609	hsa-miR-4684-5p	CLIP-seq
MIRT897612	hsa-miR-4729	CLIP-seq
MIRT2505037	hsa-miR-4732-5p	CLIP-seq
MIRT897615	hsa-miR-4769-5p	CLIP-seq
MIRT2505039	hsa-miR-526b	CLIP-seq
MIRT2505040	hsa-miR-549	CLIP-seq
MIRT2505043	hsa-miR-595	CLIP-seq
MIRT897631	hsa-miR-613	CLIP-seq
MIRT2505045	hsa-miR-633	CLIP-seq
MIRT2505046	hsa-miR-646	CLIP-seq
MIRT897634	hsa-miR-664	CLIP-seq
MIRT2505047	hsa-miR-877	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
KAT2B	Unknown	14645221

Show/Hide all (90)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000077	Process	DNA damage checkpoint signaling	IMP	21659603
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	18411297
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISS
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	ISS
GO:0003677	Function	DNA binding	IDA	11441146
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	ISS
GO:0003700	Function	DNA-binding transcription factor activity	TAS	10198158
GO:0004402	Function	Histone acetyltransferase activity	IEA
GO:0004402	Function	Histone acetyltransferase activity	IMP	21980503, 28985504
GO:0005515	Function	Protein binding	IPI	11018023, 14645221, 20861012, 21960634, 21980503, 28388406, 28514442, 28903391, 28985504, 30530698, 31515488, 32296183, 33961781
GO:0005634	Component	Nucleus	IDA	12738229, 14645221, 23229515, 28985504
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005694	Component	Chromosome	IDA	21659603
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	28985504
GO:0005829	Component	Cytosol	IEA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	ISS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	10198158
GO:0006473	Process	Protein acetylation	IDA	28985504
GO:0006974	Process	DNA damage response	IEA
GO:0007165	Process	Signal transduction	TAS	10198158
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	ISS
GO:0007623	Process	Circadian rhythm	IEA
GO:0007623	Process	Circadian rhythm	TAS	10198158
GO:0009648	Process	Photoperiodism	TAS	10198158
GO:0010468	Process	Regulation of gene expression	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0031490	Function	Chromatin DNA binding	IEA
GO:0031490	Function	Chromatin DNA binding	ISS
GO:0032922	Process	Circadian regulation of gene expression	IBA
GO:0032922	Process	Circadian regulation of gene expression	IDA	10864977, 23229515, 24005054
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	IMP	21980503, 28985504
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0033391	Component	Chromatoid body	IEA
GO:0033391	Component	Chromatoid body	ISS
GO:0042634	Process	Regulation of hair cycle	IMP	24005054
GO:0042752	Process	Regulation of circadian rhythm	IEA
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0042753	Process	Positive regulation of circadian rhythm	IDA	12738229, 23229515
GO:0042753	Process	Positive regulation of circadian rhythm	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	ISS
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	ISS
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	10864977, 23229515, 23785138
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0050796	Process	Regulation of insulin secretion	IEA
GO:0050796	Process	Regulation of insulin secretion	ISS
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	ISS
GO:0051775	Process	Response to redox state	IDA	11441146
GO:0051775	Process	Response to redox state	IEA
GO:0061733	Function	Protein-lysine-acetyltransferase activity	IEA
GO:0070888	Function	E-box binding	IBA
GO:0070888	Function	E-box binding	IDA	18411297, 23785138
GO:0070888	Function	E-box binding	IEA
GO:0071479	Process	Cellular response to ionizing radiation	IDA	21659603
GO:1990513	Component	CLOCK-BMAL transcription complex	IBA
GO:1990513	Component	CLOCK-BMAL transcription complex	IEA
GO:1990513	Component	CLOCK-BMAL transcription complex	IPI	10864977, 23229515
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000074	Process	Regulation of type B pancreatic cell development	IEA
GO:2000074	Process	Regulation of type B pancreatic cell development	ISS
GO:2000323	Process	Negative regulation of nuclear receptor-mediated glucocorticoid signaling pathway	IEA
GO:2000323	Process	Negative regulation of nuclear receptor-mediated glucocorticoid signaling pathway	ISS

MIM	HGNC	e!Ensembl
601851	2082	ENSG00000134852

O15516

Protein name

Circadian locomoter output cycles protein kaput (hCLOCK) (EC 2.3.1.48) (Class E basic helix-loop-helix protein 8) (bHLHe8)

Protein function

Transcriptional activator which forms a core component of the circadian clock. The circadian clock, an internal time-keeping system, regulates various physiological processes through the generation of approximately 24 hour circadian rhythms in g

PDB

4H10 , 6QPJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	35 → 85	Helix-loop-helix DNA-binding domain	Domain
PF00989	PAS	109 → 188	PAS fold	Domain
PF14598	PAS_11	273 → 381		Domain

Tissue specificity

TISSUE SPECIFICITY: Hair follicles (at protein level). Expressed in all tissues examined including spleen, thymus, prostate, testis, ovary, small intestine, colon, leukocytes, heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. High

Sequence

MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSL
TPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVKFIGNFKSLNSVSSSAHNGFEGTIQRT
HRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEA
LERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRQHLPAHEKMVQRRSSF
SSQSINSQSVGSSLTQPVMSQATNLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEAN
IHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPINMQGQ
VVPTNQIQSGMNTGHIGTTQHMIQQQTLQSTSTQSQQNVLSGHSQQTSLPSQTQSTLTAP
LYNTMVISQPAAGSMVQIPSSMPQNSTQSAAVTTFTQDRQIRFSQGQQLVTKLVTAPVAC
GAVMVPSTMLMGQVVTAYPTFATQQQQSQTLSVTQQQQQQSSQEQQLTSVQQPSQAQLTQ
PPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPQSHHQQHQSQQQQQLSRHRTDSLPDP
SKVQPQ

Sequence length

846

Interactions

View interactions

	KEGG		Reactome
	Circadian rhythm Dopaminergic synapse		BMAL1:CLOCK,NPAS2 activates circadian gene expression

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMERS DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL AFFECTIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (267)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute leukemia	Leukemia	BEFREE	26637877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	26637877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	31014124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	27771773, 28058013, 29113166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	25501848, 29113166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal cortical hypofunction	Adrenal Cortical Hypofunction	BEFREE	29846607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	25462064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Advanced Sleep Phase Syndrome	Advanced Sleep Phase Syndrome	BEFREE	16979429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Advanced Sleep-Phase Syndrome, Familial	Advanced Sleep Phase Syndrome	BEFREE	17299246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	23781009, 32348224, 33114015	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ametropia	Ametropia	BEFREE	29691928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	17516548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	LHGDN	17516548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	17969870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	17969870, 22538398, 22669264, 28763478, 29128257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	28752422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	17353661, 17765229, 24418196, 29590657, 30063471, 30124738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	Pubtator	35000095	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	17299247, 18787022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	37108640	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	17353661, 17765229, 24418196, 29590657, 30063471, 30124738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	24418196	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	36130474	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit and Disruptive Behavior Disorders	Attention deficit hyperactivity disorder	Pubtator	31708917	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	20704703, 30696097, 30758328, 32538895, 34273025	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	20704703, 24068320, 25135782, 26471800, 27836462, 28468274, 30025896, 30234417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28262759, 28468274, 31244687, 31682208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	12000587, 17264841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	24065634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	10904433, 11511917, 12898572, 15722957, 16528748, 18228528, 18247375, 18789374, 19909500, 20856823, 21316201, 21781277, 22080789, 22384149, 24150227 View all (13 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	LHGDN	14582141		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	17428266, 18228528, 20072116, 26283580	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	24673294, 24679394, 24865659, 25135782, 25724486		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Borderline Personality Disorder	Borderline personality disorder	BEFREE	17969870, 22806005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15703542, 20124474, 20978934, 23489707, 23725643, 24903750, 24919398, 25229211, 25485508, 26220712, 30226549, 31357909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20124474	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23822714, 24402410, 24789043, 25485508, 29958276, 31358835, 33617509, 34979978, 39193850, 39201344	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	17969870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulimia	Bulimia	BEFREE	18314271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	BEFREE	17516548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	LHGDN	17516548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20551151, 23792158, 25976934, 36595671, 37148656	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	25485508, 29113166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36595671	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31014124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	39199335	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26370682	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	18720043, 28514207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	33757590	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Restrictive	Restrictive cardiomyopathy	Pubtator	35912794	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	18071340, 19608929, 25972277, 26739996, 29360554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	18071340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	23033538, 26739996	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carnevale syndrome	3MC syndrome	BEFREE	31590444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	26739996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	26923637, 28224616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	22470559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronobiology Disorders	Chronobiology disorder	Pubtator	18228528, 23183326	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Circadian Rhythm Disorders	Circadian Rhythm Disorders	BEFREE	17395534, 25349171, 31411808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	28412756	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30315268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	37154720	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	26370682	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	35116071	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19010825, 19148895, 20551151, 21773969, 22080729, 22149272, 22166120, 23712462, 23970287, 24037774, 24277452, 24587674, 25418520, 27323779, 27492458 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20551151, 21773969, 27492458	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	29940771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cone-rod synaptic disorder, congenital nonprogressive	Congenital stationary night blindness	BEFREE	25201053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	26346429, 27000098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	26346429, 27000098		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	26346429, 27000098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing syndrome	Pubtator	21146585, 39612654	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	24729125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	23335987, 23896777, 25109449, 28585236, 29474860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Delayed Sleep Phase Syndrome	Delayed Sleep Phase Syndrome	BEFREE	11927136, 12841365, 16979429, 17299246, 21919721, 28440811, 30917702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	BEFREE	14582141, 26204460, 27992853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	10700653, 17917561, 18487629, 19926609, 20174623, 20663803, 28382017, 28721450, 29151193		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	17428266, 20149345, 24332565, 26512752, 30728411, 33809270, 37154720, 39375341	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	22535308, 22826347, 23516567, 24673294, 25522426		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	BEFREE	29105092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	17299248, 19387897, 20307570, 25457619, 25904189, 26374515, 28465284, 28721450, 29625018, 29730779, 30278816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17299248, 19387897, 20307570, 25457619, 25904189, 26374515, 28465284, 28721450, 29625018, 29730779, 30278816, 31794280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	27635400	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	26739996, 37960309	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	18974966, 22304835, 23323702, 24548145, 26374515, 26739996, 27000098, 28465284, 28830875, 29577261, 30737520, 30905809, 31476346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	28460049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diastrophic dysplasia	Diastrophic Dysplasia	BEFREE	30242505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	31406343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	17765229, 26346429, 28585194, 31613643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	17516548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	29105092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine System Diseases	BEFREE	29577261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36748323	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	18379422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	24892753, 30009381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	18720043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	17516548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	17215009, 29541184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	17215009, 29541184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	32503923	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	31612734	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	LHGDN	17696255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	30815822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	23792158, 24135790	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22905804, 23317246, 25313752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23792158, 24135790, 25976934, 33760141, 34124933	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucose Metabolism Disorders	Glucose Metabolism Disorders	BEFREE	31423784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	31328557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	31583884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	24065634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	26131842	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	19861541, 28674522, 30959483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	20124474, 36130474	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	31073199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	30728411	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	26739996, 30728411	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersomnia	Hypersomnia	BEFREE	17969870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	19846548, 26739996, 31612734, 34515147, 39809202	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	20422779, 20653450, 21286865, 25025868, 27636900, 30427705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	29111822, 30747053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	30728411	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	20541418, 22543063, 28412756, 28671110, 28986235, 29660304, 31470863, 31794280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	35000095, 36847953	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	23527142, 35000095	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	22881285, 30981000		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	37154720	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	31612734	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile Myoclonic Epilepsy	Myoclonic Epilepsy	BEFREE	24892753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratosis Follicularis	Keratosis Follicularis	BEFREE	30242505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	30132511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	26637877, 27058663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	29115399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	30518396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19675098, 27997226, 28224616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	29097215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	27635400, 35575281	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	17096334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	17096334		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	16528748, 24673294		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	16528748, 24673294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Affective Disorder 2	Major depressive disorder	Pubtator	16528748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	16528748, 24673294		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	16528748, 24673294		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	24673294		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	24673294		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	24673294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major depression, single episode	Mental Depression	BEFREE	14582141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	10898925, 12898572, 17969870, 22080789, 24001941, 24581835, 25135782, 25349171, 26926884, 29128257, 30569826		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	23273899, 24001941, 24581835, 25135782, 25349171		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	24065634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15703542, 20124474, 20978934, 23489707, 23725643, 24903750, 24919398, 25229211, 25485508, 26220712, 30226549, 31357909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	17215009, 29541184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	22436651, 23943393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31014124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	29115399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28514207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19675098, 26683776, 29113149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19752089, 25388799, 27660402, 30665264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	24708606, 30843665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	31637582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17395534, 19926609, 20600409, 21380491, 21566258, 22080729, 22081375, 22260161, 23254314, 23725643, 24062075, 24065634, 24915534, 25333958, 25855785 View all (23 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	23399917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	23242607		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	23242607, 24729125, 28799406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	33549124	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	10700653, 17917561, 18487629, 19926609, 20174623, 20663803, 28382017, 28721450, 29151193		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	22535308, 22826347, 23516567, 24673294, 25522426		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	17969870, 18516223, 19224106, 22669264, 22981886, 24687905, 25135782, 26926884, 28468274, 28902457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	17353661, 19387897, 27846625, 27864077, 28650669, 29405095, 29631363, 30169559, 30721705, 31042416, 31244204, 31794280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	32496736	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	19846548, 20961464, 23003921, 23033538, 25365257, 28296937, 36497566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	17653067, 18071340, 19276891, 19846548, 20653450, 21898035, 22623394, 23003921, 24328727, 25391456, 28296937, 29730779, 30121811, 31351068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	29946530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	22823397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	30985884, 31644470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	12898572, 15572273, 19224106, 22080789, 23951166, 25258123, 26112914, 26471800, 27102916, 27996307, 29128257, 29614896, 31323592		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood disorder	Pubtator	20149345, 27102916	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	22669264, 22906517, 23604481, 23951166, 25522426		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucopolysaccharidosis II	Mucopolysaccharidosis	BEFREE	24083598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	29324865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	29324865	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	16999817, 21454294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	27635400	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30818221, 30905809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	BEFREE	16125818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	30621723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19106159, 19148895, 21566258, 23242607, 23836662, 26943040, 28196531, 28535015, 28674522, 29113149, 29404219, 29525205, 29596780, 29940771, 29946530 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	30282019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	23292542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29557749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nevus	Nevus	BEFREE	23242607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nocturia	Nocturia	BEFREE	27348079, 28060940, 29632308, 31296902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	17696255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24821610, 30226549, 31014124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	17765229, 18071340, 18314271, 19387897, 20065968, 20205566, 20307570, 20567242, 21050724, 23003921, 23131019, 23323702, 24818524, 26346429, 26374515 View all (15 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	18541547, 19846548, 20065968, 20149345, 22310473, 23003921, 23033538, 23131019, 23183326, 24905098, 25365257, 26739996, 28645331, 28736443, 31613643 View all (11 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Obesity	Pubtator	35276838	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity Morbid	Obesity	Pubtator	36079729	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	17599055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligodendroglioma	Oligodendroglioma	Pubtator	24135790	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30363685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	28986235, 30363685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29879092, 30026846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	29879092	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	23006437	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28514207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	18720043	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19675098, 26683776, 29113149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	23254314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	22193177, 28721811, 29353016, 29535854, 31195749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	23254314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	30815822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	28468274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	27614897	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyglandular Type III Autoimmune Syndrome	Polyglandular autoimmune syndrome	BEFREE	28884339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	25135782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	26637877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	20157581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19752089, 25388799, 27660402, 30665264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19934327, 20524973, 33985534, 35154101, 35595103	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	25905433, 36419003	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	25923474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Quadriplegia	Quadriplegia	BEFREE	29985456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	30942638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	22436651, 23943393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	22923002, 23335987, 23496259, 24901009, 25109449, 25535886, 26710124, 28498398, 29217191, 30942638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	30518396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	30518396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	11511917, 17116390, 19224106, 20364331, 21050724, 21882241, 25135782		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	17116390		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	20364331		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seasonal Affective Disorder	Seasonal Affective Disorder	BEFREE	10700653		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seasonal Affective Disorder	Seasonal Affective Disorder	PSYGENET_DG	10700653, 17969870, 21835597		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seizures	Seizures	Pubtator	24892753	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	36450776	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28785808, 31403491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	23242607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	39201748, 39375341, 39940739	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep Apnea	BEFREE	30657733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep apnea	Pubtator	30657733	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	18321934, 19616563, 27798273, 29164122, 31590444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	23440187	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	11927136, 12452483, 12898572, 15187983, 15961535, 17299246, 17969870, 20307570, 20370469, 22806005, 23546644, 25201053, 27102916, 27334057, 27836462, 29958886, 29982483, 30657733 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Disorders Circadian Rhythm	Sleep disorder	Pubtator	15961535, 17428266, 28388406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Wake Disorders	Sleep Wake Disorders	LHGDN	16024980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Smith-Magenis syndrome	Smith-Magenis Syndrome	BEFREE	11445803, 16723183, 23622179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	29982483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	26943040, 28535015, 31014124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	22081375, 23784787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	27821487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	24708606, 30843665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24708606, 30843665, 34162762	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	26739996, 32349365	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28747460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	28461004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular Neoplasms	BEFREE	30959483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	30610898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	31637582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	31637582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	27079271	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	39193850	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	29989105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	10898925, 25349171, 26926884, 29128257, 30569826		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	23273899, 24001941, 24581835, 25135782, 25349171		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	32503923	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	26299356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	28058089	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CLOCK (clock circadian regulator)