Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9572
Gene name	Nuclear receptor subfamily 1 group D member 1
Gene symbol	NR1D1
Synonyms (NCBI Gene)	EAR1REVERBAREVERBalphaTHRA1THRALear-1hRev
Chromosome	17
Chromosome location	17q21.1
Summary	This gene encodes a transcription factor that is a member of the nuclear receptor subfamily 1. The encoded protein is a ligand-sensitive transcription factor that negatively regulates the expression of core clock proteins. In particular this protein repre

Show/Hide all (53)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017335	hsa-miR-335-5p	Microarray	18185580
MIRT1191990	hsa-miR-1266	CLIP-seq
MIRT1191991	hsa-miR-24	CLIP-seq
MIRT1191992	hsa-miR-4518	CLIP-seq
MIRT1191993	hsa-miR-4678	CLIP-seq
MIRT1191994	hsa-miR-4699-3p	CLIP-seq
MIRT1191995	hsa-miR-4736	CLIP-seq
MIRT2455357	hsa-miR-296-3p	CLIP-seq
MIRT2455358	hsa-miR-3151	CLIP-seq
MIRT2455359	hsa-miR-4257	CLIP-seq
MIRT2455360	hsa-miR-4265	CLIP-seq
MIRT2455361	hsa-miR-4296	CLIP-seq
MIRT2455362	hsa-miR-4322	CLIP-seq
MIRT2455363	hsa-miR-4447	CLIP-seq
MIRT2455364	hsa-miR-4472	CLIP-seq
MIRT2455365	hsa-miR-4640-5p	CLIP-seq
MIRT2455366	hsa-miR-4726-5p	CLIP-seq
MIRT2455367	hsa-miR-4728-5p	CLIP-seq
MIRT2455368	hsa-miR-491-5p	CLIP-seq
MIRT2582396	hsa-miR-1275	CLIP-seq
MIRT2582397	hsa-miR-140-5p	CLIP-seq
MIRT2455357	hsa-miR-296-3p	CLIP-seq
MIRT2582398	hsa-miR-299-5p	CLIP-seq
MIRT2455358	hsa-miR-3151	CLIP-seq
MIRT2582399	hsa-miR-3175	CLIP-seq
MIRT2455359	hsa-miR-4257	CLIP-seq
MIRT2455360	hsa-miR-4265	CLIP-seq
MIRT2455361	hsa-miR-4296	CLIP-seq
MIRT2455362	hsa-miR-4322	CLIP-seq
MIRT2455363	hsa-miR-4447	CLIP-seq
MIRT2455364	hsa-miR-4472	CLIP-seq
MIRT2582400	hsa-miR-4525	CLIP-seq
MIRT2455365	hsa-miR-4640-5p	CLIP-seq
MIRT2582401	hsa-miR-4665-5p	CLIP-seq
MIRT2582402	hsa-miR-4723-5p	CLIP-seq
MIRT2455366	hsa-miR-4726-5p	CLIP-seq
MIRT2455367	hsa-miR-4728-5p	CLIP-seq
MIRT2582403	hsa-miR-4797-5p	CLIP-seq
MIRT2455368	hsa-miR-491-5p	CLIP-seq
MIRT2582404	hsa-miR-625	CLIP-seq
MIRT2582405	hsa-miR-759	CLIP-seq
MIRT2455357	hsa-miR-296-3p	CLIP-seq
MIRT2455358	hsa-miR-3151	CLIP-seq
MIRT2455359	hsa-miR-4257	CLIP-seq
MIRT2455360	hsa-miR-4265	CLIP-seq
MIRT2455361	hsa-miR-4296	CLIP-seq
MIRT2455362	hsa-miR-4322	CLIP-seq
MIRT2455363	hsa-miR-4447	CLIP-seq
MIRT2455364	hsa-miR-4472	CLIP-seq
MIRT2455365	hsa-miR-4640-5p	CLIP-seq
MIRT2455366	hsa-miR-4726-5p	CLIP-seq
MIRT2455367	hsa-miR-4728-5p	CLIP-seq
MIRT2455368	hsa-miR-491-5p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
RORA	Activation	22024429

106

Show/Hide all (106)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	19955433
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	8622974
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	18511497
GO:0000785	Component	Chromatin	IDA	18511497
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	18511497
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	19955433
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	15761026
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IMP	8622974
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001222	Function	Transcription corepressor binding	IDA	15761026
GO:0001222	Function	Transcription corepressor binding	IMP	18006707
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	8622974
GO:0001678	Process	Intracellular glucose homeostasis	IMP	18006707
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003707	Function	Nuclear steroid receptor activity	TAS	1971514
GO:0004879	Function	Nuclear receptor activity	IBA
GO:0004879	Function	Nuclear receptor activity	TAS	8622974
GO:0005515	Function	Protein binding	IPI	17892483, 20534529, 20581824, 21874017, 22170608, 23398316, 24311788, 24737000, 26392558, 26871637, 27238018, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005634	Component	Nucleus	TAS	8622974
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005978	Process	Glycogen biosynthetic process	IEA
GO:0005978	Process	Glycogen biosynthetic process	ISS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0009755	Process	Hormone-mediated signaling pathway	IBA
GO:0010498	Process	Proteasomal protein catabolic process	IEA
GO:0010498	Process	Proteasomal protein catabolic process	ISS
GO:0016604	Component	Nuclear body	IDA
GO:0019216	Process	Regulation of lipid metabolic process	IEA
GO:0019216	Process	Regulation of lipid metabolic process	ISS
GO:0020037	Function	Heme binding	IDA	18006707
GO:0030154	Process	Cell differentiation	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0030518	Process	Nuclear receptor-mediated steroid hormone signaling pathway	IEA
GO:0030522	Process	Intracellular receptor signaling pathway	IBA
GO:0031648	Process	Protein destabilization	IEA
GO:0031648	Process	Protein destabilization	ISS
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0034144	Process	Negative regulation of toll-like receptor 4 signaling pathway	IMP	18511497
GO:0042632	Process	Cholesterol homeostasis	IDA	18511497
GO:0042632	Process	Cholesterol homeostasis	ISS
GO:0042749	Process	Regulation of circadian sleep/wake cycle	IEA
GO:0042749	Process	Regulation of circadian sleep/wake cycle	ISS
GO:0042752	Process	Regulation of circadian rhythm	IEA
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IEA
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	ISS
GO:0043197	Component	Dendritic spine	IEA
GO:0043197	Component	Dendritic spine	ISS
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0044321	Process	Response to leptin	IBA
GO:0044321	Process	Response to leptin	IEA
GO:0044321	Process	Response to leptin	ISS
GO:0045202	Component	Synapse	IEA
GO:0045598	Process	Regulation of fat cell differentiation	IEA
GO:0045598	Process	Regulation of fat cell differentiation	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	15761026, 20070857, 23398316
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	18006707, 21628546
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0050728	Process	Negative regulation of inflammatory response	ISS
GO:0060086	Process	Circadian temperature homeostasis	IEA
GO:0060086	Process	Circadian temperature homeostasis	ISS
GO:0061178	Process	Regulation of insulin secretion involved in cellular response to glucose stimulus	IEA
GO:0061178	Process	Regulation of insulin secretion involved in cellular response to glucose stimulus	ISS
GO:0061469	Process	Regulation of type B pancreatic cell proliferation	IEA
GO:0061469	Process	Regulation of type B pancreatic cell proliferation	ISS
GO:0061889	Process	Negative regulation of astrocyte activation	IEA
GO:0061889	Process	Negative regulation of astrocyte activation	ISS
GO:0070859	Process	Positive regulation of bile acid biosynthetic process	IEA
GO:0070859	Process	Positive regulation of bile acid biosynthetic process	ISS
GO:0070888	Function	E-box binding	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IMP	18511497
GO:0071347	Process	Cellular response to interleukin-1	IEA
GO:0071347	Process	Cellular response to interleukin-1	ISS
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0071356	Process	Cellular response to tumor necrosis factor	ISS
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	24162845
GO:0150079	Process	Negative regulation of neuroinflammatory response	IEA
GO:0150079	Process	Negative regulation of neuroinflammatory response	ISS
GO:1903979	Process	Negative regulation of microglial cell activation	IEA
GO:1903979	Process	Negative regulation of microglial cell activation	ISS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
602408	7962	ENSG00000126368

P20393

Protein name

Nuclear receptor subfamily 1 group D member 1 (Rev-erbA-alpha) (V-erbA-related protein 1) (EAR-1)

Protein function

Transcriptional repressor which coordinates circadian rhythm and metabolic pathways in a heme-dependent manner. Integral component of the complex transcription machinery that governs circadian rhythmicity and forms a critical negative limb of th

PDB

1A6Y , 1GA5 , 1HLZ , 3N00 , 8D8I

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00105	zf-C4	130 → 200	Zinc finger, C4 type (two domains)	Domain
PF00104	Hormone_recep	434 → 611	Ligand-binding domain of nuclear hormone receptor	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Expressed at high levels in the liver, adipose tissue, skeletal muscle and brain. Also expressed in endothelial cells (ECs), vascular smooth muscle cells (VSMCs) and macrophages. Expression oscillates diurnally in the

Sequence

MTTLDSNNNTGGVITYIGSSGSSPSRTSPESLYSDNSNGSFQSLTQGCPTYFPPSPTGSL
TQDPARSFGSIPPSLSDDGSPSSSSSSSSSSSSFYNGSPPGSLQVAMEDSSRVSPSKSTS
NITKLNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKRCLKNENCSIVRI
NRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLAEMQSAMNLANNQLSSQCPLETS
PTQHPTPGPMGPSPPPAPVPSPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIF
TYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPAPNDNNTLAAQRHNEALNGLRQ
APSSYPPTWPPGPAHHSCHQSNSNGHRLCPTHVYAAPEGKAPANSPRQGNSKNVLLACPM
NMYPHGRSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEVL
MVRFASLFNVKDQTVMFLSRTTYSLQELGAMGMGDLLSAMFDFSEKLNSLALTEEELGLF
TAVVLVSADRSGMENSASVEQLQETLLRALRALVLKNRPLETSRFTKLLLKLPDLRTLNN
MHSEKLLSFRVDAQ

Sequence length

614

Interactions

View interactions

	KEGG		Reactome
	Circadian rhythm		PPARA activates gene expression Transcriptional activation of mitochondrial biogenesis Nuclear Receptor transcription pathway Circadian Clock

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL AFFECTIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (76)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	2278973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	30028550, 30326159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	30028550, 30326159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	12021280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	25957987, 28262759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	19267705, 22538398, 25789810		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	20072116, 21781277, 21835597, 22538398, 24389266		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	21781277, 25789810	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Injuries	Brain injuries	Pubtator	37055510	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12727839, 20160030, 28249904, 28599788, 29455641, 31779659, 7511052, 9695977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17157792, 1976118, 20160030, 26074263, 31779659, 33478016, 39193850, 9143412	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	37478211	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	8630282	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	8630282	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29455641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	33846395, 35392800	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	8460637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Restrictive	Restrictive cardiomyopathy	Pubtator	35912794	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic otitis media	Otitis media	BEFREE	31122917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	37154720	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	35116071	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35880088	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	17075855, 27884645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	17075855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	22538398, 25359533		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	22538398		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	37154720	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	23671070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	32517091	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	27756900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	24914936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	CTD_human_DG	27664470		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fulminant hepatitis	Fulminant Hepatitis	BEFREE	29277561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized Thyroid Hormone Resistance	Thyroid Hormone Resistance	BEFREE	26743578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	8460637	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	27066791, 30747053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	26743578, 27066791, 30747053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	37154720	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27997226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	33846395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	19571598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12727839, 1976118, 20160030, 26074263, 28249904, 28599788, 29455641, 31779659, 7511052, 9695977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29455641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	8460637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30008829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	12231529, 15767343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28249904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	25359533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	37373286	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	25359533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	18804497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	35008743	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	1568230, 8692204, 9143412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24173768, 25089907	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30534077		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Obesity	Pubtator	24173768	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	27884645	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteochondrodysplasias	Osteochondrodysplasias	Pubtator	9463328	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	8460637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32533406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	24498227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	35168293	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seasonal Affective Disorder	Seasonal Affective Disorder	BEFREE	21835597, 22538398		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seasonal Affective Disorder	Seasonal Affective Disorder	PSYGENET_DG	21835597, 22538398		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Deprivation	Sleep deprivation	Pubtator	23440187	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	29982483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	CTD_human_DG	27664470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30008829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34162762	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombasthenia	Thrombasthenia	BEFREE	9695977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	12231529, 15767343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	12231529, 15767343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31779659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	31779659	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	19571598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Van Buchem disease	Van Buchem Disease	BEFREE	9463328		★★★★★ ★☆☆☆☆ Found in Text Mining only

NR1D1 (nuclear receptor subfamily 1 group D member 1)