Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	956
Gene name	Ectonucleoside triphosphate diphosphohydrolase 3
Gene symbol	ENTPD3
Synonyms (NCBI Gene)	CD39L3HB6NTPDase-3
Chromosome	3
Chromosome location	3p22.1
Summary	This gene encodes a plasma membrane-bound divalent cation-dependent E-type nucleotidase. The encoded protein is involved in the regulation of extracellular levels of ATP by hydrolysis of it and other nucleotides. Multiple transcript variants have been des

Show/Hide all (22)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004160	hsa-miR-192-5p	Microarray	16822819
MIRT017511	hsa-miR-335-5p	Microarray	18185580
MIRT964532	hsa-miR-1225-3p	CLIP-seq
MIRT964533	hsa-miR-1233	CLIP-seq
MIRT964534	hsa-miR-1321	CLIP-seq
MIRT964535	hsa-miR-3688-3p	CLIP-seq
MIRT964536	hsa-miR-4261	CLIP-seq
MIRT964537	hsa-miR-4694-3p	CLIP-seq
MIRT964538	hsa-miR-4728-5p	CLIP-seq
MIRT964539	hsa-miR-4738-3p	CLIP-seq
MIRT964540	hsa-miR-4739	CLIP-seq
MIRT964541	hsa-miR-4756-5p	CLIP-seq
MIRT1985827	hsa-miR-3192	CLIP-seq
MIRT1985828	hsa-miR-4314	CLIP-seq
MIRT1985829	hsa-miR-4646-5p	CLIP-seq
MIRT1985830	hsa-miR-4796-5p	CLIP-seq
MIRT1985831	hsa-miR-769-5p	CLIP-seq
MIRT1985827	hsa-miR-3192	CLIP-seq
MIRT1985828	hsa-miR-4314	CLIP-seq
MIRT1985829	hsa-miR-4646-5p	CLIP-seq
MIRT1985830	hsa-miR-4796-5p	CLIP-seq
MIRT1985831	hsa-miR-769-5p	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004050	Function	Apyrase activity	IEA
GO:0004382	Function	GDP phosphatase activity	IBA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0009134	Process	Nucleoside diphosphate catabolic process	IBA
GO:0009134	Process	Nucleoside diphosphate catabolic process	IEA
GO:0009143	Process	Nucleoside triphosphate catabolic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0017110	Function	Nucleoside diphosphate phosphatase activity	IDA	10231536, 11300774
GO:0017110	Function	Nucleoside diphosphate phosphatase activity	IEA
GO:0017111	Function	Ribonucleoside triphosphate phosphatase activity	IBA
GO:0017111	Function	Ribonucleoside triphosphate phosphatase activity	IDA	10231536, 11300774
GO:0017111	Function	Ribonucleoside triphosphate phosphatase activity	IEA
GO:0045134	Function	UDP phosphatase activity	IBA

MIM	HGNC	e!Ensembl
603161	3365	ENSG00000168032

O75355

Protein name

Ectonucleoside triphosphate diphosphohydrolase 3 (NTPDase 3) (EC 3.6.1.5) (CD39 antigen-like 3) (Ecto-ATP diphosphohydrolase 3) (Ecto-ATPDase 3) (Ecto-ATPase 3) (Ecto-apyrase 3) (HB6)

Protein function

Has a threefold preference for the hydrolysis of ATP over ADP.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01150	GDA1_CD39	49 → 480	GDA1/CD39 (nucleoside phosphatase) family	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in adult brain, pancreas, spleen and prostate (PubMed:9676430). Moderate or low expression is seen in most tissues (PubMed:9676430). Not expressed in liver and peripheral blood leukocytes (PubMed:9676430). {ECO:0000269|PubMed

Sequence

MFTVLTRQPCEQAGLKALYRTPTIIALVVLLVSIVVLVSITVIQIHKQEVLPPGLKYGIV
LDAGSSRTTVYVYQWPAEKENNTGVVSQTFKCSVKGSGISSYGNNPQDVPRAFEECMQKV
KGQVPSHLHGSTPIHLGATAGMRLLRLQNETAANEVLESIQSYFKSQPFDFRGAQIISGQ
EEGVYGWITANYLMGNFLEKNLWHMWVHPHGVETTGALDLGGASTQISFVAGEKMDLNTS
DIMQVSLYGYVYTLYTHSFQCYGRNEAEKKFLAMLLQNSPTKNHLTNPCYPRDYSISFTM
GHVFDSLCTVDQRPESYNPNDVITFEGTGDPSLCKEKVASIFDFKACHDQETCSFDGVYQ
PKIKGPFVAFAGFYYTASALNLSGSFSLDTFNSSTWNFCSQNWSQLPLLLPKFDEVYARS
YCFSANYIYHLFVNGYKFTEETWPQIHFEKEVGNSSIAWSLGYMLSLTNQIPAESPLIRL
PIEPPVFVGTLAFFTAAALLCLAFLAYLCSATRRKRHSEHAFDHAVDSD

Sequence length

529

Interactions

View interactions

	KEGG		Reactome
	Purine metabolism Pyrimidine metabolism Metabolic pathways Nucleotide metabolism Epstein-Barr virus infection		Phosphate bond hydrolysis by NTPDase proteins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Cervical cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (8)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	25311278	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31754326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34218253	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	20190036	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30449685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	30444862	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31754326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31754326		★★★★★ ★☆☆☆☆ Found in Text Mining only

ENTPD3 (ectonucleoside triphosphate diphosphohydrolase 3)